DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManVI and man2a2

Sequence 1:NP_609253.1 Gene:LManVI FlyBaseID:FBgn0032069 Length:1007 Species:Drosophila melanogaster
Sequence 2:XP_009296075.1 Gene:man2a2 ZFINID:ZDB-GENE-110331-1 Length:1174 Species:Danio rerio

Alignment Length:1099 Identity:273/1100 (25%)
Similarity:452/1100 (41%) Gaps:223/1100 (20%)


  Fly    38 INIHMVPHSHDDVGWLKTVDQYFYGHRSNIQHAGVQYIIDTVIAELIKDPARRFIQVETSFFAKW 102
            :.:.:|||||:|.||:||.|:|:     |.|   .|:|::.::.::.:||.|:||..|.|:||||
Zfish   166 LQVFVVPHSHNDPGWIKTFDKYY-----NDQ---TQHILNNMVTKMAEDPRRKFIWSEISYFAKW 222

  Fly   103 WAEQSETAKQVVRKLVNEGRLEFTGGAWSMNDEAAVNYQSVIDQFTLGLKFLDDTFGSCARPRIG 167
            |.......::|:|||:..|:||...|.|.|.|||..:|.::|||...|.::|:...|  ..||.|
Zfish   223 WESADVHKQEVMRKLILSGQLEMVTGGWVMTDEANAHYFAMIDQLIEGHQWLERNLG--VTPRSG 285

  Fly   168 WQIDPFGHSREQASIFAQMGYDGEFFARMDHRDKNDRIDNLGMEMIW-DASDSLSNDEIFTGLLY 231
            |.:||||||.....:..:.........|:.:..|........:|.:| .|.|..|:.::|..:: 
Zfish   286 WAVDPFGHSATMPYLLKRANISSMLIQRVHYSIKKHFAATRSLEFMWRQAWDIESSTDMFCHMM- 349

  Fly   232 RHYSAPPGYCFDV-H-CGDDPII----DTKSY-----------------DNNVKSRVDDFLSYVT 273
                  |.|.:|| | ||.||.|    |.|..                 |.||..|....|....
Zfish   350 ------PFYSYDVPHTCGPDPKICCQFDFKRLPGSRVNCPWKVPPRAINDANVAERAGVLLDQYR 408

  Fly   274 SVAQHYRSNHIMIPMGDDFQYEDA---QVNFKNMDKLIKYVNER-----QAEGSTFNLFYSTPAC 330
            ..::.:||..:::|:||||:|:.|   ...:.|..||..|:|..     :|:.:|.:.::.  |.
Zfish   409 KKSKLFRSKVLLVPLGDDFRYDKALEWDQQYLNYQKLFDYMNSHPEMHVKAQFATLSDYFD--AV 471

  Fly   331 Y-LNSLHEGLQ--TWPNKTQDFFPYGSDDNSYWTGYFTSRPTQKRFERDGNHILQVAKQLSVFAE 392
            | .|.:..|.:  .:|..:.|||.|...::.||:||:||||..|..:|.....|:.|:.|...|.
Zfish   472 YKANGVTSGARPPDYPVLSGDFFAYADREDHYWSGYYTSRPFYKNLDRILESHLRGAEILYSLAV 536

  Fly   393 LNTKQQKEDLEY----------LREIMGVMQHHDAITGTEKQHVSDDYDRILYDAILG----GVN 443
            .:.:....:..|          .|..:|:.|||||||||.|:.|..||...|..:::|    .:|
Zfish   537 AHARHAGVEGRYPVSDYSLLTDARRNIGLFQHHDAITGTAKEAVVIDYGNRLLRSLVGLKRVIIN 601

  Fly   444 TA-------RDGLRKLTNLPNGEFES--CLQLNISECAFTKDDADNVVVTLYNPLAHTSTQYVRV 499
            .|       :|..|.....|..|.:.  ..|.::.:....:.::....:.|:||:.......|.|
Zfish   602 AAHFLIIKNKDIYRFYQTEPFLETDDRRATQDSLPQRTLIELESSPRYLVLFNPVEQERLCLVTV 666

  Fly   500 PVKNENYEVTDEKGRVVASEVVPV---AWQVLALEFRNNDTQHELVFKASVDKIANYYIKKVASQ 561
            .|.:....|..|.|     :.:||   |..:.|.|......|...:.:.....:|.:::...|. 
Zfish   667 LVNSARVRVLTEDG-----QTLPVQLSAQWMSATEMSGEVYQASFMARLPALGLAVFHLYDSAD- 725

  Fly   562 ETKNVAAHTKSKRSIKAEEANLEVPKRFKKVHSLKNATETFDDDEGET-VVQTSQVKLVIDNKTG 625
                      |..::::|.. |.||.|.:.:..|..........:|:. .:|:..:.|.....||
Zfish   726 ----------SPMTLRSETL-LRVPGRGQSIRGLDPLPVRSQTVDGQPFYIQSQSLTLGFSGATG 779

  Fly   626 LLKTVEMNGVSENID-----QSYGVYRTYD-SGAYVFRQYHQADFIVQYEGVEFTVYDGALVKEV 684
            ||:::......:.:.     .:||...:.| ||||:|.....|....|.|.....|.:|.|..||
Zfish   780 LLESIRRKDDPQEVRVQIQFLTYGTRPSKDKSGAYLFLPDGNAKPYSQREAPIVRVVEGPLFAEV 844

  Fly   685 HQQFSEYISQVIRIYEGKNLVEIEWQVGP-IEREEEFGREVVIIFNSTIASDGVSYTDSNGREMI 748
            ...: ::..|.:||:....:..:...:.. ::..::..:|:.:.|.:.|.|....|||.||.:: 
Zfish   845 VAHY-QHFQQTVRIHNVPGVDGLSLDITTMVDIRDQNNKELAMRFVTDIQSGDTFYTDLNGFQI- 907

  Fly   749 KRVKDQRETFTPGLDRQPTAANYYPVTSRIALQDSKKRIAVLNDRAQGGASMLNGQLELMLHRRL 813
                ..|..|    .:.|..||:||:.|...:|||:.|:.:...:|.|..|:.:||||::|.|||
Zfish   908 ----QPRRYF----QKLPLQANFYPMPSTAYIQDSQYRLTLHTAQALGVTSLASGQLEVILDRRL 964

  Fly   814 VRDDGYGVGEALNEEKYGQPMIARGKVYLILSPSDESTAAEREAEKEIHLPFWKFFSKNTGSTTA 878
            ::||..|:|:.|.:.|.     ...:..|:|         ||.:.                    
Zfish   965 MQDDNRGLGQGLKDNKR-----TANRFRLLL---------ERRSN-------------------- 995

  Fly   879 AAKSVPSFNDFPKSVHLLTLEPFNDDEVLLRVENF---LDHTEGQVVSFNI--RPIFDYLNGVEI 938
            :||...|:.:....:....|....::.|..|..:|   |.|....:::..:  .|:....:||..
Zfish   996 SAKPAGSYANMLNKIIAGILGDGQEEPVDSRPVSFPSLLSHMTSTILNHEVLALPVLPRKHGVPP 1060

  Fly   939 RET--TLDGNLPLSDMKRFKFH--HDSSGQKPDAVEYFTSAHKP--------------------- 978
            ..|  .|.|.||..      ||  :..|.|.|.      .||.|                     
Zfish  1061 MRTFAPLAGTLPCD------FHLLNLRSIQSPQ------DAHSPSPYMALLLHRLGLDCGLEPQN 1113

  Fly   979 --------------------------------LAAEQSQEASEFSVTLHPMQIRTFIIK 1005
                                            |...|...:::.||:|.||:|..:.:|
Zfish  1114 PGFNCTTTQGQLSVSGLFRGLDLQLLQPMSLSLMHSQPPLSNDSSVSLEPMEISAYKLK 1172

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManVINP_609253.1 GH38N_AMII_LAM_like 38..312 CDD:212121 96/301 (32%)
Alpha-mann_mid 359..434 CDD:286360 30/85 (35%)
Glyco_hydro_38C 482..1002 CDD:285047 125/593 (21%)
man2a2XP_009296075.1 PLN02701 128..1173 CDD:178304 273/1100 (25%)
CE4_SF 165..508 CDD:301698 112/361 (31%)
Alpha-mann_mid 503..588 CDD:214875 30/85 (35%)
Glyco_hydro_38C 741..1169 CDD:285047 103/484 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.