DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManVI and man2b2

Sequence 1:NP_609253.1 Gene:LManVI FlyBaseID:FBgn0032069 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_001106515.1 Gene:man2b2 XenbaseID:XB-GENE-1006292 Length:990 Species:Xenopus tropicalis

Alignment Length:1102 Identity:310/1103 (28%)
Similarity:473/1103 (43%) Gaps:220/1103 (20%)


  Fly     7 IVLFVALLAISVRPSEEACGYEACPKTKTNMINIHMVPHSHDDVGWLKTVDQYFYGHRSNIQHAG 71
            |||.|.|.|...     .|.:.|.|      |...::||||.||||:.||.:..:.:.:|     
 Frog     2 IVLLVLLSAWGC-----VCTHSAQP------IQAFVIPHSHMDVGWVYTVQESMHAYAAN----- 50

  Fly    72 VQYIIDTVIAELIKDPARRFIQVETSFFAKWW-AEQSETAKQVVRKLVNEGRLEFTGGAWSMNDE 135
               :..||:.||::...||||.||..||..|| .......||.|.:|:.||||||..|...|:||
 Frog    51 ---VYTTVVEELMRGDRRRFIVVEQEFFRLWWKLFAGNVEKQQVHQLMREGRLEFVIGGQVMHDE 112

  Fly   136 AAVNYQSVIDQFTLGLKFLDDTFGSCARPRIGWQIDPFGHSREQASIFAQMGYDGEFFARMDHRD 200
            |.......|.|.|.|..|:.:|||  .|||..|.:||||.|....::||..|::|...:|:|:..
 Frog   113 ALTTIDDQILQLTEGHGFIYETFG--VRPRFSWHVDPFGASAASPTLFAMAGFNGHLISRIDYDT 175

  Fly   201 KNDRIDNLGMEMIWDASDSLSN-DEIFTGLLYRHYSAPPGYC-FDVHCG---------DDPIIDT 254
            |.|..:...::.||.||.|||: .||||.::.::....|.|. |....|         .||..|.
 Frog   176 KADMQNGKELQFIWRASPSLSDKQEIFTHVMDQYSYCTPSYIPFSDRSGFYWNGIAVFPDPPKDG 240

  Fly   255 KSYDNNVKSRVDDFLSYVTSVAQH-------YRSNHIMIPMGDDFQYEDAQVNFKNMDKLIKYVN 312
            ...:.::....|....|..::.::       :||:.::.|.|.|.|:.:|.|.|.|||.|:.|:|
 Frog   241 MYPNMSLPVTADTIHPYAETMVKNIKERAAWFRSSDVLWPWGCDKQFFNASVQFNNMDLLLDYIN 305

  Fly   313 ERQAEGSTFNLFYSTPACYLNSLHEGLQTWPNK-TQDFFPYGSDDNSYWTGYFTSRPTQKRFERD 376
            :....|.|..  |||...|..:|:....||..: :|||.||.||.:..|||::|||...|...|.
 Frog   306 KHTEFGVTVQ--YSTLGDYFKNLYNRNLTWGLRGSQDFLPYSSDSSQAWTGFYTSRNVLKGVARR 368

  Fly   377 GNHILQVAKQLSVFAELNTKQ---------QKEDLEYLREIMGVMQHHDAITGTEKQHVSDDYDR 432
            .:.:|..|:  |.||:...|.         ..|.|..||..:..:||||.|||||...|.|.|  
 Frog   369 ASSLLYAAE--SAFAQHLLKHPTGSVEKVWAMEQLRSLRWAVSEVQHHDGITGTESPKVRDMY-- 429

  Fly   433 ILYDAILGGVNTARDGLRKL-----TNLPNGEFESCLQLNISECAFTKDDADNVVVTLYNPLAHT 492
             :.:.:.|..     |:|||     .:|.:.:..||....|:             :|:|||||..
 Frog   430 -IANLLQGAA-----GVRKLMAAIVMDLYSSQANSCGNGYIN-------------ITVYNPLAWD 475

  Fly   493 STQYVRVPVKNENYEVTDEKGRVVASEVVPVAWQVLALEFRNNDTQHELVFKASVDKIANY--YI 555
            .|.:|.||:.|....|.|:.|:.|.:::..      |.|..|....|.||    ..|..:|  |.
 Frog   476 VTTFVLVPMNNSVSGVYDKFGQPVPAQIQN------ATEPSNAFDLHILV----TLKGLSYGRYS 530

  Fly   556 KKVASQETKN--------VAAHTKSKRSIKAEEANLEVPKRFKKVHSLKNATETFDDDEGETVVQ 612
            .|:.|.:..|        :....:.||: ||:..||..|                        :.
 Frog   531 IKLGSCDAANDRLVTGRKITFVRQPKRN-KAKRQNLVTP------------------------IM 570

  Fly   613 TSQVKLVIDNKTGLLKTVEMNGVSENIDQSYGVYRTYDSG---------AYVFRQYHQADFIVQY 668
            .....:|||..|.||.::.....::.:..:......:.:|         .|:|.....|  |..|
 Frog   571 NDCYTVVIDQNTNLLHSITARESNQTVQVTQEFLEYHSNGDISKGPISDNYLFTSTGPA--ISAY 633

  Fly   669 EGVEFTVYDGALVKEVHQQFSEYI----------SQVIRIYEG--KNLV----EIEWQVGPIERE 717
            :.|...:..|.||.|:.|.|...|          |::..:.||  |:||    |..::|||:   
 Frog   634 KAVGLEIIAGKLVTEIRQYFYSNITAQTYLYAVYSRIYNVPEGYDKSLVCHHIEQSYRVGPM--- 695

  Fly   718 EEFGREVVIIFNSTIASDGVSYTDSNGREMIKRVKDQRETFTPGLDRQPTAANYYPVTSRIALQD 782
             :..||.:|..::.:.:|.:.|||:||.:|      ||..| ...|....|.||||:.....::|
 Frog   696 -DLNRESIIRTSTDLRTDRLIYTDNNGYQM------QRRQF-KNYDTNTVARNYYPMVRTAYIED 752

  Fly   783 SKKRIAVLNDRAQGGASMLNGQLELMLHRRLVR----DDGYGVGEALNEEKYGQPMIARGKVYLI 843
            :..|:..|::||.|.:|..||::|:||||||..    |..|.:  .||:..     :.|..::|:
 Frog   753 NSTRLVFLSERAHGVSSQDNGEVEIMLHRRLWNNLEWDLNYNL--TLNDTS-----VVRPTIWLM 810

  Fly   844 LSPSDESTAAEREAEKEI-HLPFWKFFSKNTGSTTAAAKSVPSFNDFPKSVHLLTL--------- 898
            |.....:.|..:.....: |.|. ..:|.:||....:.|:.......|.::||..|         
 Frog   811 LGSRALAGALYQRLGMALEHRPL-VIYSLHTGQEKRSYKTTDLPITLPDNIHLQILSIPGWFYSS 874

  Fly   899 ---EPFND-------------DEVLLRVENFLDHTEGQV----VSFNIRPIFDYLNGVE-IRETT 942
               |...|             ..||||:::..:..|..|    |:.|::.:...|..|. :.|.:
 Frog   875 RHHEHMQDIHTGNIRDNVADFHRVLLRLQHLYETNEDPVLSKPVTINLQSLLKGLGTVSLVEERS 939

  Fly   943 LDGNLPLSDMKRFKFHHDSSGQKPDAVEYFTSAHKPLAAEQSQEASEFSVTLHPMQIRTFII 1004
            |.|...:..:||:|:..:..|..              ..|.:...|:|::||.|.:|||..:
 Frog   940 LTGTWDIHTLKRWKWKANIKGTD--------------QREHTLGTSDFTITLSPKEIRTLFV 987

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManVINP_609253.1 GH38N_AMII_LAM_like 38..312 CDD:212121 100/293 (34%)
Alpha-mann_mid 359..434 CDD:286360 30/84 (36%)
Glyco_hydro_38C 482..1002 CDD:285047 145/590 (25%)
man2b2NP_001106515.1 GH38N_AMII_Epman_like 22..346 CDD:212122 115/336 (34%)
Alpha-mann_mid 352..433 CDD:214875 30/86 (35%)
Glyco_hydro_38C 567..985 CDD:285047 112/477 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D201312at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.