DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManVI and man2a1

Sequence 1:NP_609253.1 Gene:LManVI FlyBaseID:FBgn0032069 Length:1007 Species:Drosophila melanogaster
Sequence 2:NP_001163963.1 Gene:man2a1 XenbaseID:XB-GENE-961025 Length:1150 Species:Xenopus tropicalis

Alignment Length:1099 Identity:284/1100 (26%)
Similarity:459/1100 (42%) Gaps:249/1100 (23%)


  Fly    38 INIHMVPHSHDDVGWLKTVDQYFYGHRSNIQHAGVQYIIDTVIAELIKDPARRFIQVETSFFAKW 102
            :.:.:|||||:|.|||||.|.||   |...||     |::.::.:|.:|..|:|:..|.|:|:||
 Frog   168 LQVFLVPHSHNDPGWLKTFDDYF---RDQTQH-----ILNNMVIKLQEDKNRKFMWSEISYFSKW 224

  Fly   103 WAEQSETAKQVVRKLVNEGRLEFTGGAWSMNDEAAVNYQSVIDQFTLGLKFLDDTFGSCARPRIG 167
            |.......|:.|::|:...:.|...|.|.|.|||..:|.|::||...|.::|:...|  .:|:.|
 Frog   225 WDGIDNQKKEAVKRLIELEQFEIVTGGWVMPDEATPHYFSLVDQLIEGHQWLEKNLG--VKPKSG 287

  Fly   168 WQIDPFGHSREQASIFAQMGYDGEFFARMDHRDKNDRIDNLGMEMIWDASDSLSND-EIFTGLLY 231
            |.|||||||...|.|....|.......|:.:..|........:|..|..:..|.:. :|...:: 
 Frog   288 WAIDPFGHSPTMAYILKSSGLSNMLIQRVHYSIKKYFASKQTLEFFWRQNWDLGHSTDILCHMM- 351

  Fly   232 RHYSAPPGYCFDV-H-CGDDPII----DTKSY-----------------DNNVKSRVDDFLSYVT 273
                  |.|.:|| | ||.||.|    |.|..                 :.||:.|....|....
 Frog   352 ------PFYSYDVPHTCGPDPKICCQFDFKRLPGSRVSCPWRVPPEVINEGNVQHRAWMILDQYR 410

  Fly   274 SVAQHYRSNHIMIPMGDDFQYEDA---QVNFKNMDKLIKYVNER-----QAEGSTFNLFYSTPAC 330
            ..::.||:..:::|:||||:|.|:   ...::|..||..|:|..     :|:..|.:.::.....
 Frog   411 KKSKLYRTKVLLVPLGDDFRYTDSLEWDQQYENYQKLFSYMNSHPELHVKAQFGTISDYFKALRK 475

  Fly   331 YLNSLHEGLQTWPNKTQDFFPYGSDDNSYWTGYFTSRPTQKRFERDGNHILQVAK--------QL 387
            ..|......|::|..:.|||.|...|:.||:|||||||..||.||.....|:.|:        |:
 Frog   476 AGNVDDPNSQSFPVLSGDFFTYADRDDHYWSGYFTSRPFYKRLERVMESHLRAAEILYSFALVQM 540

  Fly   388 SVFAELNTKQQKEDLEYLREI---MGVMQHHDAITGTEKQHVSDDYDRILYDAILGGVNTARDGL 449
            :.|.:|.:....|..:.|.|.   :|:.|||||||||.|..|..||...|:.:::.......|..
 Frog   541 NKFDKLQSFPSVEHYKLLTEARRNLGLFQHHDAITGTAKDWVVVDYGTRLFHSLMNLKRVIIDAA 605

  Fly   450 RKLTNLPNGEFESCLQLNISECAFTKDDA----DNV-------------VVTLYNPLAHTSTQYV 497
            ..|.......:    ..|.|...|:.||.    |::             .:|:|||........|
 Frog   606 HVLVLKDKDTY----AYNPSSPFFSMDDVQPSQDSLPQKTVIKITEIPRYLTVYNPTEQERYSVV 666

  Fly   498 RVPVKNENYEVTDEKGRVVASEVVPVAWQVLALEFRNNDT-----QHELVFKASVDKIANYYIKK 557
            .|.|.:...:|....|:.:.:::..| |        |.|:     .:::.|.|.:..:.....|.
 Frog   667 SVYVSSSKVKVISASGKALKAQISAV-W--------NGDSAPLQDMYQVSFLAYLPALGLAVYKL 722

  Fly   558 VASQETKNVAA-----------HTKSKRSIKAEEANLEVPKRFKKVHSLKNATETFDDDEGETVV 611
            |.::.::::.|           :..|..:.:.:|.|:.|                     |:..:
 Frog   723 VEAENSESIKADYTIFVQGKHKNINSDGNFRIKEVNIVV---------------------GDVTI 766

  Fly   612 QTSQVKLVIDNKTGLLKTVEM--NGVSENIDQS---YGVYRTYD-SGAYVFRQYHQADFIVQYEG 670
            :.:.:||.. :.:|||:.::.  :|.:..:...   ||.....| ||||:|....:|...:..:.
 Frog   767 ENTYLKLWF-SSSGLLEKIQSKEDGKTHGVKVDFIWYGTTNNRDKSGAYLFLPDGEAKPYINADP 830

  Fly   671 VEFTVYDGALVKEVHQQFSEYISQVIRIY-----EGK-----NLVEIEWQVGPIEREEEFGREVV 725
            ....|..|::..|| ..|.::::..:|:|     ||:     |:|:|         ..||.||:|
 Frog   831 PVVRVTHGSIFSEV-VVFFKHLTHTVRLYNVHGLEGQSPEITNVVDI---------RGEFNREIV 885

  Fly   726 IIFNSTIASDGVSYTDSNGREMIKRVKDQRETFTPGLDRQPTAANYYPVTSRIALQDSKKRIAVL 790
            :...|.|.|....|||.||.::     ..|.|    |.:.|..||.||:||...:||...|:.:.
 Frog   886 MRITSDINSKHRFYTDLNGYQI-----QPRRT----LSKLPIQANVYPMTSMAYIQDDASRLTLH 941

  Fly   791 NDRAQGGASMLNGQLELMLHRRLVRDDGYGVGEALNEEKYGQPMIARGKVYLILSP---SDESTA 852
            :.::.|.||..:||||:.|.|||::||..|:|:.:.:.|     |......|:|..   .|    
 Frog   942 SAQSLGVASSKSGQLEVFLDRRLMQDDNRGLGQGVQDNK-----ITSNLFRLLLEKRFGKD---- 997

  Fly   853 AEREAEKEIHLP-----FWKFF----------SKNTGSTTAAAKSVPSFNDFPKSVHLLTLE--- 899
             |:|.||.:..|     ....|          :.::||:......:|..:..|..||||.|.   
 Frog   998 -EKEDEKPVSYPSILSHITSMFLNHPVIPMAATSDSGSSVLLNAFLPLTSSMPCDVHLLNLRTIQ 1061

  Fly   900 ----PFNDDE--VLLRVENF------------LDHTEGQVVSFNIRPIFDYLNGVEIRETTLDGN 946
                |...||  ::|..:.|            ...|:|:|   ::..:|   ||..| |:.:..:
 Frog  1062 AKVGPIPSDEAALILHRKGFDCKFSNKDLGLLCSTTQGKV---SVHRLF---NGFNI-ESLIPSS 1119

  Fly   947 LPLSDMKRFKFHHDSSGQKPDAVEYFTSAHKPLAAEQSQEASEFSVTLHPMQIRTFIIK 1005
            |.|.        |.||..|                      :...:.:..|.|:||.||
 Frog  1120 LTLM--------HSSSNSK----------------------NTTEIRISTMDIKTFRIK 1148

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManVINP_609253.1 GH38N_AMII_LAM_like 38..312 CDD:212121 93/301 (31%)
Alpha-mann_mid 359..434 CDD:286360 35/86 (41%)
Glyco_hydro_38C 482..1002 CDD:285047 133/591 (23%)
man2a1NP_001163963.1 PLN02701 130..1150 CDD:178304 284/1100 (26%)
CE4_SF 167..509 CDD:301698 108/358 (30%)
Alpha-mann_mid 504..590 CDD:214875 35/86 (41%)
Glyco_hydro_38C 755..1145 CDD:285047 114/478 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.