DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManVI and man2b2

Sequence 1:NP_609253.1 Gene:LManVI FlyBaseID:FBgn0032069 Length:1007 Species:Drosophila melanogaster
Sequence 2:XP_001337519.3 Gene:man2b2 ZFINID:ZDB-GENE-140106-166 Length:1006 Species:Danio rerio

Alignment Length:1095 Identity:304/1096 (28%)
Similarity:493/1096 (45%) Gaps:196/1096 (18%)


  Fly    10 FVALLAISVRPSEEACGYEACPKTKTNMINIHMVPHSHDDVGWLKTVDQYFYGHRSNIQHAGVQY 74
            |..||.::|..::.|           ..|...::||||.||||:.||.:..:.:.||        
Zfish     6 FFGLLLMTVSENDAA-----------EKIQAFVIPHSHMDVGWVYTVQESMHAYASN-------- 51

  Fly    75 IIDTVIAELIKDPARRFIQVETSFFAKWWAE-QSETAKQVVRKLVNEGRLEFTGGAWSMNDEAAV 138
            :..||:.||.:...|:||.||..||..||.. .|:..|:.||:|:.||||||..|...|:|||..
Zfish    52 VYSTVVEELTRVKNRKFIAVEQEFFRLWWTNVASDWHKKQVRQLLLEGRLEFIIGGQVMHDEAVT 116

  Fly   139 NYQSVIDQFTLGLKFLDDTFGSCARPRIGWQIDPFGHSREQASIFAQMGYDGEFFARMDHRDKND 203
            :....|.|.|.|..||.:|||  .|||..|.:||||.|.....:||..|:|....:|:|:..|:|
Zfish   117 DVDDAILQLTEGHGFLYETFG--VRPRFAWHVDPFGASATTPVLFALAGFDAHLISRIDYDLKDD 179

  Fly   204 RIDNLGMEMIWDASDSL-SNDEIFTGLLYRHYSAPPGYC-FDVHCG---------DDPIIDTKSY 257
            ...|..::.:|..|.:| ...||||..:.:.....|.|. |....|         .||..|.| |
Zfish   180 MQKNKKLQFVWRGSPTLKEKQEIFTHTMDQFSYCTPSYIPFSNRSGFYWNGVALFPDPPKDGK-Y 243

  Fly   258 DN--------NVKSRVDDFLSYVTSVAQHYRSNHIMIPMGDDFQYEDAQVNFKNMDKLIKYVNER 314
            .|        .|:......:..:...||.:||:|::.|.|.|.|:.:|.|.|.|||.|:.|:|..
Zfish   244 PNMSLPVTKETVELYAQTMVDNIRLRAQWFRSSHVLWPWGCDKQFYNASVQFSNMDVLMNYINTH 308

  Fly   315 QAE-GSTFNLFYSTPACYLNSLHEGLQTWPNK-TQDFFPYGSDDNSYWTGYFTSRPTQKRFERDG 377
            ..: |.|..  |:|...|..:||:...:|..: .|||.||.::....|||::.||...|...|..
Zfish   309 SDQYGVTVQ--YATLKDYFQTLHQTNLSWDVRGNQDFLPYSTEPFQAWTGFYGSRNVLKGVARRA 371

  Fly   378 NHILQVAKQLSVFAELNTKQ-----QKE----DLEYLREIMGVMQHHDAITGTEKQHVSDDYDRI 433
            :.:|..::  |:|...:...     |:|    .|:.||..:..:||||.|||||...|:|.|   
Zfish   372 SSLLYASE--SLFTRYHISYPDGPVQREWALSKLKALRWAVSEVQHHDGITGTESPKVADMY--- 431

  Fly   434 LYDAILGGVNTARDGLRKLTNLPNGEFESCLQLNISECAFT-KDDADNVV---VTLYNPLAHTST 494
             .:.:|.|:..|.:.|..:..||. ...:.:...|.....| :.|::||.   :.:|||||...:
Zfish   432 -MEHLLQGMMGAEELLAAIFLLPQ-TLSNDIYDQIKNTPTTARTDSENVPEQHIFVYNPLAWNIS 494

  Fly   495 QYVRVPVKNENYEVTDEKGRVVASEVVPVAWQVLALEFRNNDTQHELVFKASVDKIANYYIKKVA 559
            .||.|.|:.....|.|:.|:.|.:::.|      ::|   :.|.::|.|   |.::.....:|..
Zfish   495 TYVNVSVQYAMAVVLDDDGKAVPAQIQP------SME---SSTVYDLFF---VVELGGLQYRKYT 547

  Fly   560 SQ------ETKNVAAHTKSKRSIKAEEANLEVPKRFKKVHSLKNATETFDDDEGETV--VQTSQV 616
            .|      :|.:....|...:.:|..:.|:   :::||.              |..:  |.....
Zfish   548 VQFPQSPCDTGSACGATHVAKVVKFNKTNV---RQWKKT--------------GRKLLPVLNECY 595

  Fly   617 KLVIDNKTGLLKTV--EMNGVSENIDQSYGVYRT---YDSGA----YVFRQYHQADFIVQYEGVE 672
            ||:.|.:|.||.::  ....:...:.|.:..|:.   ..||.    |:|.....|  :..|:.|.
Zfish   596 KLMFDQETNLLHSITDRSKKIRVRVQQDFWEYKANGDVQSGPISDNYIFTANGSA--VPAYKSVV 658

  Fly   673 FTVYDGALVKEVHQQF-------SEYISQVIRI---YEGK---NLVEIEWQVGPIEREEEFGREV 724
            ..:..|.::.|:.|.|       :...|.|.|:   ::|:   ..:|..::|||:    |..||.
Zfish   659 MEIVPGKVISEIRQYFYREEEDANHTYSVVTRVPVGFKGRLSCFRLEQSYKVGPL----EVNRET 719

  Fly   725 VIIFNSTIASDGVSYTDSNGREMIKRVKDQRETFTPGLDRQPTAANYYPVTSRIALQDSKKRIAV 789
            |....:::.::...:||:||.:|:||      |: .|......|.||||:.....::|...|:..
Zfish   720 VFRTRTSLQNNRTLFTDNNGYQMMKR------TY-KGYANNTVARNYYPMVRVAYMEDESSRVVF 777

  Fly   790 LNDRAQGGASMLNGQLELMLHRRLVR----DDGYGVGEALNEEKYGQPMIARGKVYLIL-SPSDE 849
            |::||.|.||:..||||:||||||..    :.||.:  .||:....:|::     :::| ||...
Zfish   778 LSERAHGVASLSQGQLEVMLHRRLWNNQEWNQGYNL--TLNDSSVVRPVL-----WMMLGSPDSL 835

  Fly   850 STAAEREAEKEIHLPFWKFFSK-----NTGSTTAAAKSVPSFND--FPKSVHLLTL--------- 898
            |:..::||.:..|.|......:     |...|.    |.||.:.  .|:::|:.:|         
Zfish   836 SSIYQQEAVELQHRPVVMAIDQPQKLLNQRETF----SGPSVHPVVLPQNLHMQSLSIPGWNYSP 896

  Fly   899 ---------EPFNDDEVLLRVENFLDHTEGQVVS----FNIRPIFDYLNGV-EIRETTLDGNLPL 949
                     ...|.|.:|||:.:..:..|..|:|    .|::.:...:..| :::|.:|.|...:
Zfish   897 EHSSGGDEKSEVNFDRILLRITHLYEEGESPVLSQPTTINLKEVMQGIGKVSKVQECSLTGTWNI 961

  Fly   950 SDMKRFKFHHDSSGQKPDAVEYFTSAHKPLAAEQSQEASEFSVTLHPMQIRTFII 1004
            ||::|:.:..|.:.||.|...:            |....:|:||:.|.:||||.|
Zfish   962 SDLQRWNWKTDETMQKTDKSGF------------SGVTQDFNVTISPKEIRTFFI 1004

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManVINP_609253.1 GH38N_AMII_LAM_like 38..312 CDD:212121 104/294 (35%)
Alpha-mann_mid 359..434 CDD:286360 27/84 (32%)
Glyco_hydro_38C 482..1002 CDD:285047 141/588 (24%)
man2b2XP_001337519.3 PLN02701 20..1002 CDD:178304 298/1078 (28%)
GH38-57_N_LamB_YdjC_SF 23..348 CDD:330225 118/338 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D201312at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11607
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.