DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and AMS1

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_011359.1 Gene:AMS1 SGDID:S000003124 Length:1083 Species:Saccharomyces cerevisiae

Alignment Length:1019 Identity:199/1020 (20%)
Similarity:338/1020 (33%) Gaps:310/1020 (30%)


  Fly    37 MVNIHLVPHSHNDVGWLKTVDQSYYGYKNKIHHAGVQYILDSVVSQ-LLQD--PKRRFIQVETAF 98
            :.|::.:.:.|.|..||....::    :.|        |:.|..|| .|.|  |:.:|:..:...
Yeast   288 LTNVYGIGNCHIDTAWLWPFAET----RRK--------IVRSWSSQCTLMDRFPEYKFVASQAQQ 340

  Fly    99 FAKW-WNVQSESMKKVVTKLVNEGRFEFTGGAWSMNDEANVNYQGVIDQFTVGLKFLNETFGSCG 162
            | || .....|...||:...:.:.:|...||.|..||....:.:.:..||..|.:|..:.||.  
Yeast   341 F-KWLLEDHPEFFNKVLIPKIQQSQFFAVGGTWVENDTNIPSGESLARQFFFGQRFFLKHFGL-- 402

  Fly   163 RPRVGWQIDTFGHSREQAAIFAHMGYDGQFFSRMDHNDKDTRMNDLTMEMIWDASESMSGVSLFS 227
            :.::.|..||||:|.:...:....|.| :|               ||.::.|      :.::.|.
Yeast   403 KSKIFWLPDTFGYSSQMPQLCRLSGID-KF---------------LTQKLSW------NNINSFP 445

  Fly   228 GMLYNFYSDTPGFCFDILCTDQPIIDGDSEENNVKQRVDDFISYAK-NVSEVYITNHIMVPMGGD 291
            ...:|:    .|.....|.|..|    ............|.:..|| |.:..|..:.:|:...||
Yeast   446 HSTFNW----AGIDGSQLLTHMP----PGNTYTADSHFGDVLRTAKQNKTPEYYGSGLMLYGKGD 502

  Fly   292 FQYEDAKVNYKNMDKLIKYINERQAS-------GSKYNIFYSTPSCYLNSLHQSLESWPNKTQDF 349
            ......:...:.| :.|:.:|.|..:       |...:.||.......|..| .|.:|..:.  :
Yeast   503 GGGGPTEEMLQKM-RRIRSMNNRNGNVIPKLQVGITVDEFYDDILKRTNQGH-DLPTWSGEL--Y 563

  Fly   350 FPYAHEKNSFWTGFFTSRPTQKRFERDGN---HMLQ-VAKQLSVLANLTSEEHKIDLDYLRQVMG 410
            |       .|..|.:||:...|:..|...   |.|: :|.:.|||...:.:.....::.|.:.:.
Yeast   564 F-------EFHRGTYTSQAQTKKLMRLSEIKLHDLEWIAAKTSVLYPDSYKYPSKQINELWENVL 621

  Fly   411 VMQHHDAITGTEKQAVSDDYDRMMYEAIVGASNNARDA---------------------LRLLT- 453
            :.|.||.:.|:..:.|      ..|||:....|..::.                     :|.|| 
Yeast   622 LCQFHDVLPGSCIEMV------YKYEAVPMLHNVVKECTSLIDKTVQFLQSQSKADLVEMRTLTW 680

  Fly   454 NMPYGEFESCLRLNISECAFTKD--GADNVLVTLYNPL---------------------AHSSTQ 495
            :.|....|.| .||.|   :|..  |.|:.:|.....|                     .:..|:
Yeast   681 SKPEKVSEEC-SLNGS---YTSSVTGYDDYIVLANGKLKVIICKKTGVITSITDETLGVEYLDTE 741

  Fly   496 YVRIPVKEENYQVTDEKGRTVPSEVVPVPWQVLALE-YRSNDTQHELVFKATVNKVSSYSIKKVE 559
            :.|..:....:.:.|:|         |:.||....| |..|  |::.|.|.          |||:
Yeast   742 HGRNKLGANQFVIYDDK---------PLGWQAWDTELYSVN--QYKYVTKP----------KKVQ 785

  Fly   560 SSEVKHSSIKKINPREDNNSETVV---ENSVVKLVMDNHTGRLKSVEMNGVS-EKIVQNFGVYKS 620
            .|         .|.:|....|.:.   |...:|.|:..:...:...:::.|. ...|:|:.....
Yeast   786 VS---------CNTKEKCAVEVIFQISEKCKIKSVISLNATAVTDAKLSKVDISTTVENWDARNK 841

  Fly   621 HTSCAYTFRQDGDIELFENDFEFTVYEGSLVKEVHQHVNDWISQVIRIYEGVSRVEL-------- 677
            .....:......|...:|..|..|       |....:...|         .|::.|:        
Yeast   842 FLKVEFPVNIRNDFASYETQFGIT-------KRPTHYNTSW---------DVAKFEVCHHKFADY 890

  Fly   678 -EWMVGPIPIDD-KLGSEFVTNFKSEISSNGVFYTDSNGRELMKRVKDKREDFVSDLSRQPVSGN 740
             |:..|...::| |.|                |.|..|...|......|..|..:|:....:...
Yeast   891 SEYSKGVSILNDCKYG----------------FSTHGNLMRLSLLRSPKAPDAHADMGTHEIKYA 939

  Fly   741 FYPVTSRIALQDDTKRLVLLNDRSQGGASLEDGALEMLIHRRHLFNDGGGVGEALNETQYGKGLI 805
            .||  .|.||..||.:|.                        |.||                   
Yeast   940 IYP--HRGALSSDTVKLA------------------------HEFN------------------- 959

  Fly   806 ARGKLYLILDSATDGDTVTERKTEKELFLPFWKFFSKTG--GVEITPSKSLPDFNDLPQSVHLLT 868
                 |..           :.|..|::.:.|....|.:|  .|.::..|...|.:.:..:..|..
Yeast   960 -----YCF-----------KYKLPKDIGMNFDDIISISGDENVILSNIKRGEDDSAVKSNYSLNP 1008

  Fly   869 LEFFSEQEILIRFEHFLDKSEGRVISFNIRDIFDSLGG--LAIRETTLDGNMPLSDMKRFKFHAQ 931
            .:   ||.|::|                   :::||||  .|...|||       ::||.:    
Yeast  1009 RD---EQSIVVR-------------------VYESLGGESFASLNTTL-------NLKRIE---- 1040

  Fly   932 ESGTKPSSVEYSTAQHKPLEAVKSDEASLFAVTLYPMQIRTFII 975
                |..::|...  :|.|.|.: ||:: .|:...|:::|.|.|
Yeast  1041 ----KVDNLEMKV--YKSLTATR-DESN-HAINRIPIKLRPFEI 1076

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 60/278 (22%)
Alpha-mann_mid 359..434 CDD:214875 18/79 (23%)
Glyco_hydro_38C 483..973 CDD:285047 93/530 (18%)
AMS1NP_011359.1 AMS1 44..1083 CDD:223460 199/1020 (20%)
GH38N_AMII_ScAms1_like 290..548 CDD:212123 65/304 (21%)
Alpha-mann_mid 565..646 CDD:286360 21/87 (24%)
Glyco_hydro_38C 672..1079 CDD:285047 107/574 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65915925
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.