DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and AT5G66150

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_201416.1 Gene:AT5G66150 AraportID:AT5G66150 Length:1047 Species:Arabidopsis thaliana

Alignment Length:1072 Identity:357/1073 (33%)
Similarity:555/1073 (52%) Gaps:148/1073 (14%)


  Fly     5 GRILFLSILLVLFAKQSEAVCGYESCPETKANMV----NIHLVPHSHNDVGWLKTVDQSYYGYKN 65
            |.:..:..||:|...:|....||... .|:|.:|    |:|||||||:||||||||||.|.|..|
plant    11 GSLCVIVFLLLLSLVESVKGGGYVKY-GTEAKVVPGKLNVHLVPHSHDDVGWLKTVDQYYVGSNN 74

  Fly    66 KIHHAGVQYILDSVVSQLLQDPKRRFIQVETAFFAKWWNVQSESMKKVVTKLVNEGRFEFTGGAW 130
            :|.:|.|:.:|||||..||:||.|:|:..|.|||.:||..||...::.|.:||..|:.||..|.|
plant    75 RIQNACVRNVLDSVVDSLLRDPNRKFVFAEMAFFTRWWEEQSPERQEQVRRLVKSGQLEFVNGGW 139

  Fly   131 SMNDEANVNYQGVIDQFTVGLKFLNETFGSCGRPRVGWQIDTFGHSREQAAIF-AHMGYDGQFFS 194
            :|||||..:|..:|||.|.|.:|:.:.|.:  .||..||||.||||..||.:. |.:|.|...|:
plant   140 AMNDEATCHYIDMIDQTTKGHRFIKQQFNT--TPRAAWQIDPFGHSSVQAYLLGAELGLDSVHFA 202

  Fly   195 RMDHNDKDTRMNDLTMEMIWDASESM-SGVSLFSGMLYNFYSDTPGFCFDIL-----CTDQPIID 253
            |:|:.|::.|..:.::|:||..|::: |...:|:.:.:..|....||.:::.     ..|.|..|
plant   203 RIDYQDREKRKAEKSLEVIWRGSKTLDSSSQIFTNIFFVHYGPPTGFHYEVTDDYVPLQDNPRFD 267

  Fly   254 GDSEENNVKQRVDDFISYAKNVSEVYIT----NHIMVPMGGDFQYEDAKVNYKNMDKLIKYINER 314
            |    .|:|:.|:||:    |.|.||..    ||:|..||.||||:.|:..::.||:||.|:|: 
plant   268 G----YNIKEAVNDFV----NASLVYANVSRGNHVMWTMGDDFQYQFAESWFRQMDRLIHYVNK- 323

  Fly   315 QASGSKYNIFYSTPSCYLNSLHQSLESWPNKTQDFFPYAHEKNSFWTGFFTSRPTQKRFERDGNH 379
               ..:.|..|||||.|:::.:.:..:||.||.||||||....::|||:|||||..||:.|..:.
plant   324 ---DGRVNALYSTPSLYVDAKNVANVTWPLKTHDFFPYADRAYAYWTGYFTSRPALKRYVRALSG 385

  Fly   380 MLQVAKQLSVLANLTSEEHKIDLDY-LRQVMGVMQHHDAITGTEKQAVSDDYDRMMYEAIVGASN 443
            ....|:||..|....|....   .| |...:|:.|||||:|||.||.|::||   |....:|||.
plant   386 YYMAARQLEFLVGKNSGGPN---TYSLGDALGIAQHHDAVTGTAKQHVTNDY---MKRLALGASE 444

  Fly   444 N---ARDALRLLTN-MPYGE--------FESCLRLNISECAFTKD---GADNVLVTLYNPLAHSS 493
            .   ...||..|.| .|.|.        .:.|..:|||.|..|::   |..::::..||.|..:.
plant   445 AEAVVNSALACLMNKAPKGGCTKPAIAFSQQCSLMNISYCPSTEETLPGQKSLILVAYNSLGWNR 509

  Fly   494 TQYVRIPVKEENYQVTDEKGRTVPSEVVPVPWQVLALEYRSNDT------------QHELVFKAT 546
            |:.:||||.:....|.|..|.|:.::.:|:  ..:....||..|            ::.|||||.
plant   510 TEIIRIPVNDAGLSVEDSSGNTLDAQYIPM--DNVTSNLRSFYTKAYLGISSLQRPKYWLVFKAK 572

  Fly   547 VNKV--SSYSIKKVE---SSEVKHSSIKKINPREDNNSETVVENSVVKLVMDNHTGRLKSV--EM 604
            |..:  :::.|.|..   |:..||||: .::|.   |:.|.:....:|:|..:.:|||:.:  ..
plant   573 VPPLGWNTFFISKASAQGSNNHKHSSV-MLSPM---NNTTEIGPGNLKMVFSSDSGRLERMYNSR 633

  Fly   605 NGVSEKIVQNFGVYKSH--------TSCAYTFRQDGDI--------------ELFEN---DFEFT 644
            .|...|:.||:..|.|:        .|.||.||.:|.:              ....|   ..:..
plant   634 TGADIKVDQNYFWYASNVGDAKDPQVSGAYIFRPNGSLAYPVSSSKICTVTSAFIGNGNVQSKLQ 698

  Fly   645 VYEGSLVKEVHQHVNDWISQVIRIYEGVSRVELEWMVGPIPI--DDKLGSEFVTNFKSEISSNGV 707
            :..|.|:.||||..:.|::||:|:|:.....|.|:.:|||.:  ....|.|.:|...:::::...
plant   699 IVRGPLIDEVHQQFSPWVAQVVRLYKEKEHAEFEFTIGPISVGKGHLTGKEIITRMVTDMTTAKE 763

  Fly   708 FYTDSNGRELMKRVKDKREDFVSDLSRQPVSGNFYPVTSRIALQDDTKRLVLLNDRSQGGASLED 772
            ||||||||:.:|||:|.|.|:..::: :|::||:||:...:.::|:...|.:|.||:.||||::|
plant   764 FYTDSNGRDFLKRVRDNRTDWHLEVN-EPIAGNYYPLNLGMYIKDEKAELSVLVDRATGGASIKD 827

  Fly   773 GALEMLIHRRHLFNDGGGVGEALNET----QYGKGLIARGKLYLILDSATDGDTVTERKTEKELF 833
            |.:|:::|||...:|..||.|:|.||    ....||..||..|:.::...:|.. ..|:|.:|::
plant   828 GEIELMLHRRTSMDDSRGVEESLVETVCVNDTCAGLTIRGNYYVSINKVGEGGR-WRRETGQEIY 891

  Fly   834 LPF-----------WKFFSKTGGVEITPSKSLPDFNDLPQSVHLLTLEFFSEQEILIRFEHFLDK 887
            .|.           ||..:...|.      ::.....|||::.|:|||......:|:|..|..:.
plant   892 SPLLMAFAHENKEKWKASNTVKGY------AMDHLYTLPQNIALITLEELDLGNVLLRLAHLYEA 950

  Fly   888 SE----GRVISFNIRDIFDSLGGLAIRETT---LDGNMPLSDMK-RFKFHAQESGTKPSSVEYST 944
            .|    .::....::.:|   .|..|:|.|   |..|.....|| :.|:..:....:|||     
plant   951 GEDSDYSKIAKVELKKLF---SGKMIKEVTEMSLSANQEKVKMKEKMKWKVEGEAEQPSS----- 1007

  Fly   945 AQHKPLEAVKSDEASLFAVTLYPMQIRTFIIK 976
                ||.....|:::| .|.|.||:||||:::
plant  1008 ----PLRGGPVDKSTL-VVELGPMEIRTFVVQ 1034

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 121/284 (43%)
Alpha-mann_mid 359..434 CDD:214875 32/76 (42%)
Glyco_hydro_38C 483..973 CDD:285047 158/559 (28%)
AT5G66150NP_201416.1 GH38N_AMII_LAM_like 47..323 CDD:212121 122/286 (43%)
Alpha-mann_mid 365..438 CDD:214875 33/79 (42%)
Glyco_hydro_38C 498..1031 CDD:285047 158/560 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 649 1.000 Inparanoid score I165
OMA 1 1.010
OrthoDB 1 1.010 D201312at2759
OrthoInspector 1 1.000 T32165
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11607
Phylome 1 0.910 0.722 Consistency score
77.080

Return to query results.
Submit another query.