DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and AT5G13980

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_196902.2 Gene:AT5G13980 AraportID:AT5G13980 Length:1024 Species:Arabidopsis thaliana

Alignment Length:1043 Identity:375/1044 (36%)
Similarity:549/1044 (53%) Gaps:113/1044 (11%)


  Fly     7 ILFLSILLVLFAKQSEAVCGYESCPETKANMVNIHLVPHSHNDVGWLKTVDQSYYGYKNKIHHAG 71
            :|.|.|.||    :|..:. |.:........:|:|:|||||:||||||||||.|.|..|.|..|.
plant    11 VLLLGISLV----ESRYMV-YNTSHTIVPGKLNVHVVPHSHDDVGWLKTVDQYYVGSNNSIQVAC 70

  Fly    72 VQYILDSVVSQLLQDPKRRFIQVETAFFAKWWNVQSESMKKVVTKLVNEGRFEFTGGAWSMNDEA 136
            ||.:|||:|..||.|..|:||.||.|||.:|||.|||.:|::|.:|::.|:.|...|...|:|||
plant    71 VQNVLDSIVPALLADKNRKFIYVEQAFFQRWWNEQSEEIKRIVKELIHSGQLELINGGMCMHDEA 135

  Fly   137 NVNYQGVIDQFTVGLKFLNETFGSCGRPRVGWQIDTFGHSREQAAIF-AHMGYDGQFFSRMDHND 200
            ..:|..:|||.|:|.:|:...|..  .||:|||||.||||..||.:. |.:|:|..||.|:|:.|
plant   136 APHYIDMIDQTTLGHRFIIREFNV--TPRIGWQIDPFGHSAVQAYLLGAEVGFDSVFFGRIDYQD 198

  Fly   201 KDTRMNDLTMEMIWDASESM-SGVSLFSGMLYNFYSDTPGFCFDILCTDQPIIDGDSE--ENNVK 262
            ::.|..:.|:|:||..|:|: |...:|:|.....|...||..:..:..|.|::..|.:  :.||:
plant   199 REKRYKEKTLEVIWRGSKSLGSSSQIFAGAFPTNYEPPPGGFYYEITDDSPVVQDDPDLFDYNVQ 263

  Fly   263 QRVDDFISYAKNVSEVYITNHIMVPMGGDFQYEDAKVNYKNMDKLIKYINERQASGSKYNIFYST 327
            :||:.|::.|.:.:.:...||||..||.||:|:.|...|:.|||||.|:|    ...:.|.||||
plant   264 ERVNAFVAAALDQANITRINHIMFTMGTDFRYQYAHTWYRQMDKLIHYVN----LDGRVNAFYST 324

  Fly   328 PSCYLNSLHQSLESWPNKTQDFFPYAHEKNSFWTGFFTSRPTQKRFERDGNHMLQVAKQLSVLAN 392
            ||.|.::.|.:.|:||.||:|:||||...|::|||:|||||..||:.|..:.....|:||.....
plant   325 PSIYTDAKHAANEAWPLKTEDYFPYADRINAYWTGYFTSRPALKRYVRVMSAYYLAARQLEFFKG 389

  Fly   393 LTSEEHKIDLDYLRQVMGVMQHHDAITGTEKQAVSDDYDRMMYEAIVGASNNARDALRLLTNM-- 455
            .:.:..  :.|.|...:.:.|||||::||.||.|::||.:.:....|.|.:....:|..||.:  
plant   390 RSQKGP--NTDSLADALAIAQHHDAVSGTSKQHVANDYAKRLAIGYVEAESVVATSLAHLTKVDP 452

  Fly   456 ---PYGEFESCLRLNISECAFTK----DGADNVLVTLYNPLAHSSTQYVRIPVKEENYQVTDEKG 513
               |  .|:.||.||||.|..::    || .:::|..||||.......||:||...:..|.|.:|
plant   453 TLNP--TFQQCLLLNISYCPSSEVNLSDG-KSLIVLAYNPLGWKRVDIVRLPVVGGDVSVHDSEG 514

  Fly   514 RTVPSEVVPVPWQVLAL-EYR------SNDTQ---HELVFKATV-------------NKVSSYSI 555
            ..|.|::||...:.:|| :|.      .:.||   :.|||..||             .|...||.
plant   515 HEVESQLVPFTDEYVALRKYHVEAYLGQSPTQVPKYWLVFSVTVPPLGFTTYTISTAKKTDGYSS 579

  Fly   556 KKVESSEVK-HSSIKKINPREDNNSETVVENSVVKLVMDNHTGRLKSVEMNGVSEKIVQNFGVYK 619
            |...|:.:| ..||..|.......|.:..:.:.:..|    .||      ..::|.:.|.|..|.
plant   580 KSYVSNILKGEQSIINIGHGHLKLSFSTDQGTAINYV----NGR------TSMTEPVKQTFSYYS 634

  Fly   620 SH------------TSCAYTFRQDGDIELF-ENDFEFTVYEGSLVKEVHQHVNDWISQVIRIYEG 671
            ::            .|.||.||.:|...:. |.....||..|.||.||||.:|.||||:.|:|:|
plant   635 AYNGSNDKEPLIPQNSGAYVFRPNGTFPINPEGQVPLTVIHGPLVDEVHQQINPWISQITRVYKG 699

  Fly   672 VSRVELEWMVGPIPIDDKLGSEFVTNFKSEISSNGVFYTDSNGRELMKRVKDKREDFVSDLSRQP 736
            ...||:|::||.|||||.:|.|.||...|.:.||..|||||:||:.:||::|.|.|:..|:: ||
plant   700 KEHVEVEFIVGNIPIDDGIGKEVVTQISSSLKSNKTFYTDSSGRDYIKRIRDYRSDWKLDVN-QP 763

  Fly   737 VSGNFYPVTSRIALQDDTKRLVLLNDRSQGGASLEDGALEMLIHRRHLFNDGGGVGEALNET--- 798
            ::||:||:...|.|||..|...::.||:.||:|:.||.:|:::|||.|.:|..||.|.||||   
plant   764 IAGNYYPINHGIYLQDSKKEFSVMVDRAFGGSSIVDGQVELMLHRRLLLDDSRGVAENLNETVCV 828

  Fly   799 -QYGKGLIARGKLYLILDSATDGDTVTERKTEKELFLPFWKFFSKT--------GGVE---ITPS 851
             ....||..:||.|..:|...:| ....|...:|::.|....|::.        |...   |.||
plant   829 QDKCTGLTIQGKYYYRIDPYGEG-AKWRRTFGQEIYSPLLLAFAQQDDGKPMSFGAASFSGIDPS 892

  Fly   852 KSLPDFNDLPQSVHLLTLEFFSEQEILIRFEHFL----DKSEGRVISFNIRDIF--DSLGGLAIR 910
            .||||      :|.||||:...:..:|:|..|..    ||....|.|..::.:|  ..:|.|.  
plant   893 YSLPD------NVALLTLQELDDGNVLLRLAHLYEVEEDKELSGVASVELKKLFPGKKIGKLT-- 949

  Fly   911 ETTLDGNMPLSDMKRFKFHAQESGTKPSSVEYSTAQHKPLEAVKSDEASLFAVTLYPMQIRTFII 975
            |.:|..|...|.|::.:...:..|      |.|..:.|..:..:..:.....:.||||:|||.:|
plant   950 EMSLSANQERSTMEKKRLVWKVEG------EGSYGEEKKAKRGREIDPRKLEMELYPMEIRTVLI 1008

  Fly   976 KTE 978
            ..|
plant  1009 HLE 1011

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 123/277 (44%)
Alpha-mann_mid 359..434 CDD:214875 28/75 (37%)
Glyco_hydro_38C 483..973 CDD:285047 178/548 (32%)
AT5G13980NP_196902.2 GH38N_AMII_LAM_like 37..313 CDD:212121 123/278 (44%)
Alpha-mann_mid 356..429 CDD:214875 28/75 (37%)
Glyco_hydro_38C 594..1006 CDD:285047 144/438 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 649 1.000 Inparanoid score I165
OMA 1 1.010
OrthoDB 1 1.010 D201312at2759
OrthoInspector 1 1.000 T32165
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11607
Phylome 1 0.910 0.722 Consistency score
77.080

Return to query results.
Submit another query.