DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and AT3G26720

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_189306.1 Gene:AT3G26720 AraportID:AT3G26720 Length:1019 Species:Arabidopsis thaliana

Alignment Length:1039 Identity:371/1040 (36%)
Similarity:552/1040 (53%) Gaps:114/1040 (11%)


  Fly     8 LFLSILLVLFAKQSEAVCGYESCPETKANMVNIHLVPHSHNDVGWLKTVDQSYYGYKNKIHHAGV 72
            |:|.:..::....:.....|.:.|......:|:|||||||:||||||||||.|.|..|.|..|.|
plant     8 LYLILAAIVIGGVTSEYIEYNTKPRIVPEKINVHLVPHSHDDVGWLKTVDQYYVGSNNSIRGACV 72

  Fly    73 QYILDSVVSQLLQDPKRRFIQVETAFFAKWWNVQSESMKKVVTKLVNEGRFEFTGGAWSMNDEAN 137
            |.:||||::.||.|..|:||.||.|||.:||..||.:.|..|.|||:.|:.||..|...|:|||.
plant    73 QNVLDSVIASLLDDENRKFIYVEMAFFQRWWRQQSNAKKVKVKKLVDSGQLEFINGGMCMHDEAT 137

  Fly   138 VNYQGVIDQFTVGLKFLNETFGSCGRPRVGWQIDTFGHSREQAAIF-AHMGYDGQFFSRMDHNDK 201
            .:|..:|||.|:|.:|:...||..  ||||||||.||||..||.:. |..|:|..||:|:|:.|:
plant   138 PHYIDMIDQTTLGHQFIKTEFGQV--PRVGWQIDPFGHSAVQAYLLGAEFGFDSLFFARIDYQDR 200

  Fly   202 DTRMNDLTMEMIWDASESM-SGVSLFSGMLYNFYSDTPGFCFDILCTDQPIIDGD-SEENNVKQR 264
            ..|:.:.|:|:||..|:|: |...:|:|:....|....||.|:|.....||.|.. ..:.||::|
plant   201 AKRLREKTLEVIWQGSKSLGSSSQIFTGVFPRHYDPPEGFTFEINDVSAPIQDDPLLFDYNVQER 265

  Fly   265 VDDFISYAKNVSEVYITNHIMVPMGGDFQYEDAKVNYKNMDKLIKYINERQASGSKYNIFYSTPS 329
            |:||::.|.....|..|||||..||.||:|:.|...::.:||.|.|:|:    ..:.|:.|||||
plant   266 VNDFVAAALAQVNVTRTNHIMWLMGTDFRYQYAYSWFRQIDKFIHYVNK----DGRLNVLYSTPS 326

  Fly   330 CYLNSLHQSLESWPNKTQDFFPYAHEKNSFWTGFFTSRPTQKRFERDGNHMLQVAKQLSVLANLT 394
            .|.::.:.:.||||.||.||||||.:.|::|||:|||||..|::.||.:.....|:||..|....
plant   327 IYTDAKYAANESWPLKTDDFFPYADKPNAYWTGYFTSRPAFKKYVRDLSGYYLAARQLEFLRGRD 391

  Fly   395 SEEHKIDLDYLRQVMGVMQHHDAITGTEKQAVSDDY------DRMMYEAIVGASNNARDALRLLT 453
            |.....|:  |...:.:.|||||::||::|.|:.||      ..:..|.:|.:|.:...|.:..|
plant   392 SSGPTTDM--LADALAIAQHHDAVSGTQRQHVAADYALRLSMGYLQAEKLVASSLSFLSAAKSST 454

  Fly   454 NM--PYGEFESCLRLNISECAFTKD---GADNVLVTLYNPLAHSSTQYVRIPVKEENYQVTDEKG 513
            ..  |..:|:.|..||||.|..::.   ...:::|.:||.|.....:.||:||..||..|.|..|
plant   455 EKKNPGTKFQQCPLLNISYCPASEARLLSGKSLVVVVYNSLGWKREEVVRVPVSSENVIVKDASG 519

  Fly   514 RTVPSEVVPVPWQVLALEYRS-----------NDT-QHELVFKATVNKV--SSYSIKKV------ 558
            :.|..:::|:  ..:||..|:           .|| :|.|.|.|:|..:  |||.|...      
plant   520 KEVVFQLLPL--SEIALRIRNEYVKAYLGRSPRDTAKHVLAFTASVPPLGFSSYVISDTGRTARG 582

  Fly   559 ------------ESSEVKHSSIK--------KINPREDNNSETVVENSVVKLVMDNHTGRLKSVE 603
                        ::.||...::|        ||.......::...|.|....:..|.|.  |..:
plant   583 LSASYVTSGSMNQNVEVGQGNLKLRYSEEGVKITRHLSTKNQVTAEQSYAYYIGSNGTD--KDPQ 645

  Fly   604 MNGVSEKIVQNFGVYKSHTSCAYTFRQDGDIEL-FENDFEFTVYEGSLVKEVHQHVNDWISQVIR 667
            .:|                  ||.||.||.:.: .:.:.:.|:.:|.|..||||.:|.||||:.|
plant   646 ASG------------------AYVFRPDGVLPIKSKEEAQLTIVQGPLFDEVHQELNSWISQITR 692

  Fly   668 IYEGVSRVELEWMVGPIPIDDKLGSEFVTNFKSEISSNGVFYTDSNGRELMKRVKDKREDFVSDL 732
            :|:|.:..|:|:.:||||.||.:..|.:|...:.:.:||.||||||||:.:||::|.|.|:  ||
plant   693 VYKGKNHAEIEFTIGPIPADDGISKEIITKLTTTMKTNGTFYTDSNGRDFIKRIRDFRTDW--DL 755

  Fly   733 S-RQPVSGNFYPVTSRIALQDDTKRLVLLNDRSQGGASLEDGALEMLIHRRHLFNDGGGVGEALN 796
            . .|||:||:||:...|.:||.|..|.:|.||:.||:|||:|.:|:::|||...:|..||||.||
plant   756 QVYQPVAGNYYPLNLGIYMQDKTSELSVLVDRAVGGSSLENGQIELMLHRRMQHDDIRGVGEILN 820

  Fly   797 ET----QYGKGLIARGKLYLILDSATDGDTVTERKTEKELFLPFWKFFSKTGG------VEITPS 851
            ||    :..|||..:||.|:.:|...|| ....|...:|::.|....|::..|      .:.|.|
plant   821 ETVCLPEGCKGLTIQGKFYVQIDKPGDG-AKWRRTFGQEIYSPLLIAFTEQEGDSWINSHKTTFS 884

  Fly   852 KSLPDFNDLPQSVHLLTLEFFSEQEILIRFEHFLDKSEGRVIS----FNIRDIFDSLGGLAIRET 912
            ...|.:: ||::|.||||:.....|:|:|..|..:..|....|    ..::.:|.:.....::||
plant   885 AFEPSYS-LPKNVALLTLQELENGEVLLRLAHLFEVGEDSEYSVMAKVELKKLFHNKKIREVKET 948

  Fly   913 TLDGNMPLSDMKRFKFHAQESGTKPSSVEYSTAQHKPLEAVKSDEASLFAVTLYPMQIRTFIIK 976
            :|.||...::|::.:...:..|:....|       |..|||   :|....|.|.||:|||.:||
plant   949 SLSGNQEKAEMEKRRLIWKVEGSAGEEV-------KRGEAV---DAEKLVVELVPMEIRTLLIK 1002

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 129/276 (47%)
Alpha-mann_mid 359..434 CDD:214875 29/81 (36%)
Glyco_hydro_38C 483..973 CDD:285047 173/546 (32%)
AT3G26720NP_189306.1 PLN02701 36..997 CDD:178304 363/1005 (36%)
GH38N_AMII_LAM_like 38..314 CDD:212121 130/278 (47%)
Alpha-mann_mid 356..429 CDD:214875 29/75 (39%)
Glyco_hydro_38C 488..999 CDD:285047 173/547 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 649 1.000 Inparanoid score I165
OMA 1 1.010
OrthoDB 1 1.010 D201312at2759
OrthoInspector 1 1.000 T32165
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11607
Phylome 1 0.910 0.718 Consistency score
77.080

Return to query results.
Submit another query.