DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and man2b1

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_001072469.1 Gene:man2b1 XenbaseID:XB-GENE-958698 Length:995 Species:Xenopus tropicalis

Alignment Length:1007 Identity:427/1008 (42%)
Similarity:595/1008 (59%) Gaps:68/1008 (7%)


  Fly     7 ILFLSILLVLFA---KQSEAVCGYESCPETKANMVNIHLVPHSHNDVGWLKTVDQSYYGYKNKIH 68
            :|.|.:||:..|   ||:|. ||.:|||:.....:|:||:||:||||||||||||.|||..|.|.
 Frog     6 LLLLPLLLLGAAGRLKQAEG-CGEQSCPQAPDGFLNVHLIPHTHNDVGWLKTVDQYYYGAHNDIQ 69

  Fly    69 HAGVQYILDSVVSQLLQDPKRRFIQVETAFFAKWWNVQSESMKKVVTKLVNEGRFEFTGGAWSMN 133
            ||||||||||||||||.||.:|||.||:|||.:||..|.|.:::.||:||.|||.||..|.||||
 Frog    70 HAGVQYILDSVVSQLLHDPSKRFIYVESAFFWRWWKQQDELVRRDVTRLVEEGRLEFINGGWSMN 134

  Fly   134 DEANVNYQGVIDQFTVGLKFLNETFGSCGRPRVGWQIDTFGHSREQAAIFAHMGYDGQFFSRMDH 198
            |||..:|..:|||.|:||:||..|||.||||||.|.||.||||||||.:||.|||||.||.|:|:
 Frog   135 DEAATHYSSIIDQMTLGLQFLKSTFGDCGRPRVAWHIDPFGHSREQALLFAQMGYDGFFFGRLDY 199

  Fly   199 NDKDTRMNDLTMEMIWDASESMSG--VSLFSGMLYNFYSDTPGFCFDILCTDQPIIDGDS-EENN 260
            .||..|.....|||:|.||:.:|.  ..||:|:|.|.|:...|||:|.||.|.||||..| |:.|
 Frog   200 QDKANREKTKQMEMLWRASDDISPPYADLFTGVLPNGYNPPDGFCWDQLCDDTPIIDDPSVEDYN 264

  Fly   261 VKQRVDDFISYAKNVSEVYITNHIMVPMGGDFQYEDAKVNYKNMDKLIKYINERQASGSKYNIFY 325
            ....|..|:..|...::.|:::||::.||.|||||:|.:.:||||:|||.:|.:|.:|||.|:||
 Frog   265 ADVIVQKFLKAATQQAQKYLSSHIVMTMGSDFQYENAIMWFKNMDRLIKNVNMQQINGSKVNVFY 329

  Fly   326 STPSCYLNSLHQSLESWPNKTQDFFPYAHEKNSFWTGFFTSRPTQKRFERDGNHMLQVAKQLSVL 390
            |||||||.|||::..:||.|..||||||...:.||||:|||||..|.:||..|:.|||..|:..|
 Frog   330 STPSCYLQSLHRANLTWPMKMDDFFPYADGPHMFWTGYFTSRPAFKGYERLSNNFLQVCNQMEAL 394

  Fly   391 ANLTSEE---HKIDLDYLRQVMGVMQHHDAITGTEKQAVSDDYDRMMYEAIVGASNNARDALRLL 452
            :.|.:..   .:.....:|:.|||.|||||:|||.||.|::||...:.|..........::|..|
 Frog   395 SGLEARNGPYGQSSSTVMRRAMGVAQHHDAVTGTAKQHVNNDYSLRLSEGWDSCQVVISNSLSSL 459

  Fly   453 TNMPYGEFESCLRLNISECAFTKDGADNVLVTLYNPLAHSSTQYVRIPVKEENYQVTDEKGRTVP 517
            |... ..|..|..||||.|..| :.|:|..|.|||||..|.|..||:||....|:|......|||
 Frog   460 TGTK-ENFAFCNLLNISVCHVT-ETANNFKVYLYNPLGRSVTWTVRLPVNGHAYKVIGPNDETVP 522

  Fly   518 SEVVPVPWQVLALEYRSNDTQHELVFKATVNKV--SSYSIKKVESSE---VKHSSIKKINPREDN 577
            ||||.|.....||.::....:.||:|:..:..|  ||:::.|:...:   :|....||   :.|.
 Frog   523 SEVVDVSDFTKALRFQQGGAERELIFQGQIPAVGFSSFTVGKLSLPDRFVIKGKRGKK---QPDK 584

  Fly   578 NSETVVENSVVKLVMDNHTGRLKSVE--MNGVSEKIVQNFGVY--------KSHTSCAYTFRQDG 632
                 ::|...::..|..||.:..:.  ...:|..:.|:|..|        .|..|.||.||.:.
 Frog   585 -----IQNQYYRVDFDPETGLISGIHNLEKKISLPLKQSFYWYNASVGNEESSQPSGAYIFRPNN 644

  Fly   633 --DIELFENDFEFTVYEGSLVKEVHQHVNDWISQVIRIYEGVSRVELEWMVGPIPIDDKLGSEFV 695
              .:.:.::...:.| :.|||:||||:.:.|.|||:|:|.....:||||.|||:||.|:.|.|.:
 Frog   645 SDSVPVSQHVRSYLV-QNSLVQEVHQNFSSWCSQVVRLYRDQRYIELEWTVGPVPIGDEWGKEVI 708

  Fly   696 TNFKSEISSNGVFYTDSNGRELMKRVKDKREDFVSDLSRQPVSGNFYPVTSRIALQDDTKRLVLL 760
            :..::.:.::||||||||||:::||.:|.||.:..: ..:|::||:|||.|||.::....::.:|
 Frog   709 SLIETNLKTDGVFYTDSNGRQILKRRRDSRETWKLN-QTEPIAGNYYPVNSRIYIKGKNTQVTVL 772

  Fly   761 NDRSQGGASLEDGALEMLIHRRHLFNDGGGVGEALNET-QYGKGLIARGKLYLILDSATDGDTVT 824
            .||||||:|:.||:||:::|||.|.:|..||||.|.|. ..|:|::.||:..|:||.| |....|
 Frog   773 TDRSQGGSSIRDGSLELMVHRRLLRDDYRGVGEPLLENGLLGEGIVVRGRHLLLLDHA-DEAADT 836

  Fly   825 ERKTEKELFLPFWKFFSKTGGVEI----TPSKSLPDFN-DLPQSVHLLTLEFFSEQEILIRFEHF 884
            .|....:.::......|...|:..    ||.:.....| :|||:.||||....:..:||:|.||.
 Frog   837 HRTLALQQYMSPQVVLSSGDGIPYSQSGTPKRKFSALNGELPQNGHLLTFAMHAADKILLRLEHP 901

  Fly   885 L----DKSEGRVISFNIRDIFDSLGGLAIRETTLDGNMPLSDMKRFKFHAQESGTKPSSVEYSTA 945
            .    .|:..:.|:.|:..:|.|:......||||..||..|.:||              :::.|.
 Frog   902 FQSQESKNNSQPITINLNTLFSSVSLSNFEETTLGANMEKSRLKR--------------LQWRTR 952

  Fly   946 QHKPLEAVKSDEASLF---AVTLYPMQIRTFI 974
            ...||: :.|..|.:.   .:||.||:||||:
 Frog   953 TGSPLQ-MDSPRAPVVDPSNITLSPMEIRTFL 983

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 160/276 (58%)
Alpha-mann_mid 359..434 CDD:214875 36/78 (46%)
Glyco_hydro_38C 483..973 CDD:285047 176/520 (34%)
man2b1NP_001072469.1 PLN02701 39..987 CDD:178304 414/974 (43%)
GH38N_AMII_LAM_like 39..317 CDD:212121 161/278 (58%)
Alpha-mann_mid 363..441 CDD:214875 36/78 (46%)
Glyco_hydro_38C 585..982 CDD:285047 141/415 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64876353
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D201312at2759
OrthoFinder 1 1.000 FOG0001898
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.800

Return to query results.
Submit another query.