DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and man2b1

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:XP_005169420.1 Gene:man2b1 ZFINID:ZDB-GENE-050327-52 Length:984 Species:Danio rerio

Alignment Length:1018 Identity:429/1019 (42%)
Similarity:603/1019 (59%) Gaps:98/1019 (10%)


  Fly     7 ILFLSILLVLFAKQSEAVCGYESCPETKANMVNIHLVPHSHNDVGWLKTVDQSYYGYKNKIHHAG 71
            :||...|:........::|||:|||.||.:|:|:|||||:|:||||||||||.:||.:|.|.|||
Zfish    13 LLFCFSLVFSLPTGRNSICGYKSCPATKPSMLNVHLVPHTHDDVGWLKTVDQYFYGDRNNIQHAG 77

  Fly    72 VQYILDSVVSQLLQDPKRRFIQVETAFFAKWWNVQSESMKKVVTKLVNEGRFEFTGGAWSMNDEA 136
            ||||||||:.||.:||.||||.||||||.:||..|:::.:::||:||||||.||..|.|.|:|||
Zfish    78 VQYILDSVIDQLQKDPARRFIYVETAFFYRWWRQQNQNTRRIVTQLVNEGRLEFINGGWCMSDEA 142

  Fly   137 NVNYQGVIDQFTVGLKFLNETFGSCGRPRVGWQIDTFGHSREQAAIFAHMGYDGQFFSRMDHNDK 201
            ..:|..||||.|:||:|||:|||.||||||.|.||.|||:||.|:|||.|||||.||.|:|:.||
Zfish   143 TTHYSAVIDQMTLGLRFLNDTFGECGRPRVAWHIDPFGHAREHASIFAQMGYDGFFFGRLDYQDK 207

  Fly   202 DTRMNDLTMEMIWDASESMSG--VSLFSGMLYNFYSDTPGFCFDILCTDQPIIDG-DSEENNVKQ 263
            |.||....|||:|.||||::.  ..||:|:|.|.|:...|||:|..|.|.||.|. |.|:.||.:
Zfish   208 DRRMKTKEMEMLWRASESLTPPIADLFTGVLPNGYNPPEGFCWDQSCDDAPIRDDPDLEDYNVDE 272

  Fly   264 RVDDFISYAKNVSEVYITNHIMVPMGGDFQYEDAKVNYKNMDKLIKYINERQASGSKYNIFYSTP 328
            .|..|::.:...::.|.||||::.||.|||||:|.:.||||||||||:|..||.|||.|:.||||
Zfish   273 IVQKFLNASHKQADYYKTNHIIMTMGSDFQYENANLWYKNMDKLIKYVNALQAKGSKLNVLYSTP 337

  Fly   329 SCYLNSLHQSLESWPNKTQDFFPYAHEKNSFWTGFFTSRPTQKRFERDGNHMLQVAKQLSVLANL 393
            ||||..|:.:..:||.||.||||||.:.:.||||:|||||..|.:||..|..||...||.||...
Zfish   338 SCYLQELNLANFTWPMKTDDFFPYADDAHDFWTGYFTSRPALKLYERLSNSRLQTCNQLEVLGGP 402

  Fly   394 TSEEHKI---DLDYLRQVMGVMQHHDAITGTEKQAVSDDYDRMM------YEAIVG---ASNNAR 446
            ||.....   |.|.:|:.|||.|||||::|||||.|::||.|.:      .|.:|.   |..:..
Zfish   403 TSTSGPFGEGDSDTMRRAMGVAQHHDAVSGTEKQHVANDYARRLATGWAHCEVLVSNSLAVLSGS 467

  Fly   447 DALRLLTNMPYGEFESCLRLNISECAFTKDGADNVLVTLYNPLAHSSTQYVRIPVKEENYQVTDE 511
            :|.|:.          |..||||.|..| :.:....:.:||||..:....||:||....|.|||.
Zfish   468 EAPRVF----------CENLNISVCPLT-ESSHKFSMNVYNPLGRTVRWPVRLPVNGSVYNVTDA 521

  Fly   512 KGRTVPSEVVPVPWQVLALEYRSNDTQHELVFKATVNKV--SSYSIKKVESSEVKHSSIKKINP- 573
            .|:.|.|||:|:......:.......:.||||:.....:  |:|.|..|:...          | 
Zfish   522 NGKAVDSEVIPLSKSRKEVRQNRGFAKSELVFQVEAPPLGYSTYIISMVQDQP----------PV 576

  Fly   574 -REDNNSETVVENSVVKLVMDNHTGRLKSVEMNGVSE--KIVQNFGVY--------KSH-TSCAY 626
             |..|...:.::|..:|:..|:.||.|.|:......:  ::.|||..|        :|| .|.||
Zfish   577 SRSKNAVPSSIQNKFLKVTFDSTTGLLSSLTNLETQQTIRLTQNFFWYNASAGNNKESHQPSGAY 641

  Fly   627 TFR-QDGDIELFENDFEF---TVYEGSLVKEVHQHVNDWISQVIRIYEGVSRVELEWMVGPIPID 687
            .|| ...|..:.....|.   ::|..  |:||.|..:.|:|||:|:||....:||||.|||:|::
Zfish   642 IFRPNSSDPFIISKTAEIQAVSLYNS--VQEVTQRFSPWVSQVVRLYEDRRELELEWTVGPVPVE 704

  Fly   688 DKLGSEFVTNFKSEISSNGVFYTDSNGRELMKRVKDKREDFVSDLSR-QPVSGNFYPVTSRIALQ 751
            |.||.|.:|...::|.|:|.|||||||||:::|.||.|..:  ||.: :|::||:||:.||..::
Zfish   705 DGLGKEVITRLDTDIQSSGYFYTDSNGREVLERRKDYRPTW--DLKQTEPIAGNYYPINSRAYIK 767

  Fly   752 DDTKRLVLLNDRSQGGASLEDGALEMLIHRRHLFNDGGGVGEALNET-QYGKGLIARGKLYLIL- 814
            ||.::|.::.|||||.:|:.:|:||:::|||.|::|..||||.|:|. ::..||:|||:|.|.| 
Zfish   768 DDKRQLTVVTDRSQGASSIYNGSLEIMLHRRLLYDDFRGVGEPLSEPGEFAHGLVARGRLLLTLS 832

  Fly   815 --DSATDGDTVTERKTEKELFL-PFWKFFSKTGGVEITPSKSLPDFND----LPQSVHLLTLEFF 872
              ::|.|    ..|...:.:.| |...|  :.|..  :|...| :|:.    ||.:|||||:..:
Zfish   833 PPEAAAD----LHRPLAQSMVLQPLLSF--QDGAP--SPGTKL-EFSGLQAALPPAVHLLTVSQW 888

  Fly   873 SEQEILIRFEHFLDKSEGRV----ISFNIRDIFDSLGGLAIRETTLDGNMPLSDMKRFKFHAQES 933
            .:..:|:|.||.....|.:.    ::.|::.:|.:|..|...|.:|..|....||.|..::.::.
Zfish   889 DQDSVLVRLEHQYQAKESKTHSQPVTVNLQKLFSTLQVLGASEMSLGANQWKEDMIRLHWNTEKD 953

  Fly   934 GTKPSSVEYSTAQHKPLEAVKSDEASLFAVTLYPMQIRTFIIK 976
            ...|      ||:          :.|.:.|||.||:||||:::
Zfish   954 ALPP------TAR----------DPSSWEVTLKPMEIRTFLLR 980

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 163/276 (59%)
Alpha-mann_mid 359..434 CDD:214875 41/78 (53%)
Glyco_hydro_38C 483..973 CDD:285047 174/523 (33%)
man2b1XP_005169420.1 PLN02701 44..982 CDD:178304 417/988 (42%)
GH38N_AMII_LAM_like 44..322 CDD:212121 164/278 (59%)
Alpha-mann_mid 368..446 CDD:214875 41/78 (53%)
Glyco_hydro_38C 558..977 CDD:285047 152/458 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64829649
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D201312at2759
OrthoFinder 1 1.000 FOG0001898
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11607
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.