DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and man2a2

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_001006777.1 Gene:man2a2 XenbaseID:XB-GENE-981388 Length:909 Species:Xenopus tropicalis

Alignment Length:777 Identity:223/778 (29%)
Similarity:354/778 (46%) Gaps:138/778 (18%)


  Fly    38 VNIHLVPHSHNDVGWLKTVDQSYYGYKNKIHHAGVQYILDSVVSQLLQDPKRRFIQVETAFFAKW 102
            :.:.:|||||||.||:||.|:.||..        .|:||:::|.:|.:||:|:||..|.:||:||
 Frog   166 LQVFVVPHSHNDPGWIKTFDKYYYDQ--------TQHILNNMVVKLHEDPRRKFIWSEISFFSKW 222

  Fly   103 WNVQSESMKKVVTKLVNEGRFEFTGGAWSMNDEANVNYQGVIDQFTVGLKFLNETFGSCGRPRVG 167
            |:..:...:..|.:||..|:.|.|.|.|.|.||||.:|..:|||...|.::|.:...:  .||.|
 Frog   223 WDNINSQKRAAVRRLVASGQLEMTTGGWVMPDEANTHYFAMIDQMIEGHQWLKKNLDA--TPRSG 285

  Fly   168 WQIDTFGHSREQAAIFAHMGYDGQFFSRMDHNDKDTRMNDLTMEMIWDAS-ESMSGVSLFSGMLY 231
            |.:|.||||.....|............|:.::.|.......::|.:|..: :..|...:|..|: 
 Frog   286 WAVDPFGHSSTMPYILRRSNLTSMLIQRVHYSIKKHFAATQSLEFMWRQTWDPDSSTDIFCHMM- 349

  Fly   232 NFYS-DTPGFC---------FD--------ILC----TDQPIIDGDSEENNVKQRVDDFISYAKN 274
            .||| |.|..|         ||        |.|    ..:.|.|     :||.:|.:..:...|.
 Frog   350 PFYSYDVPHTCGPDPKICCQFDFRRLPGGRINCPWKVPPRAITD-----SNVAERANILLDQYKK 409

  Fly   275 VSEVYITNHIMVPMGGDFQYE-----DAKVNYKNMDKLIKYINER-----QASGSKYNIFYSTPS 329
            .|::|.:..::||:|.||:|:     ||:  :.|..||..|:|..     ||.       :.|.|
 Frog   410 KSKLYRSKVVLVPLGDDFRYDKIQEWDAQ--FLNYQKLFDYMNSHPELHVQAQ-------FGTLS 465

  Fly   330 CYLNSLHQSL--------ESWPNKTQDFFPYAHEKNSFWTGFFTSRPTQKRFERDGNHMLQVAKQ 386
            .|.::|::.:        ..:|..:.|||.||..::.:|||::||||..|..:|.....|:.|:.
 Frog   466 DYFDALYKRMGVVPGIKPPDFPVVSGDFFSYADREDHYWTGYYTSRPFYKSMDRVLESHLRGAEI 530

  Fly   387 LSVL----ANLTSEEHKIDL-DY-----LRQVMGVMQHHDAITGTEKQAVSDDYDRMMYEAIVGA 441
            |..|    |.....|.|..| ||     .|:.:|:.|||||||||.|:||..||...:..:::..
 Frog   531 LYSLAINHARKAGTESKYPLSDYALLTDARRNLGLFQHHDAITGTAKEAVVIDYGVRLLHSLMNL 595

  Fly   442 SN---NARDALRLLTNMPYGEFESCLRLNISECAFTKDG----------ADNVLVTLYNPLAHSS 493
            ..   ||...|.:.....|....|....:..|...|::.          |....|.::||:..:.
 Frog   596 KRIIINAAHYLVVADKEKYHYDHSVPFFSTDESRLTQESLPEKTVIKLTASPRYVVVFNPVEQNR 660

  Fly   494 TQYVRIPVKEENYQVTDEKGRTVPSEVVPVPWQVLALEYRSNDTQHELVFKATVNKVSSYSIKKV 558
            ...|.:.|...|.:|..|.|:.|.:::.|| ||.:.   ..|...:::.|.|.:..: ..||.::
 Frog   661 LCVVSLLVNTYNVRVLTEDGQPVAAQLSPV-WQSVT---DMNPDVYQVSFTARLPSL-GLSIFQL 720

  Fly   559 ESSEVKHS---------------SIKK-----INPREDNNSETVVENSVVKLVMDNHTGRLKSVE 603
            .:|...|:               ||||     :...|.:..:..:||..:::.....||.|||::
 Frog   721 HASIDTHTTLKSNVRVHLHGRELSIKKQDVFPVKVAESSTDDFHIENQYMQVWFSGTTGLLKSIK 785

  Fly   604 MNG--VSEKIVQNFGVYKSHT----SCAYTFRQDGDIELF--ENDFEFTVYEGSLVKEV---HQH 657
            ..|  ..:||...|.:|.:.|    |.||.|..||:.:.:  ::.....|.||....||   :||
 Frog   786 RAGEEQEQKINMQFLIYGTRTSKDKSGAYLFLPDGEAKPYTPKDPPVVKVTEGPFYSEVTCQYQH 850

  Fly   658 VNDWISQVIRIY-----EGVSRVELEWMVGPIPIDDKLGSEFVTNFKSEISSNGVFYTDSNG 714
            |    .||:|:|     ||:| :::..:   |.|.|.:..|......::|.|..:|:||.||
 Frog   851 V----QQVMRLYNLPGTEGLS-LDISSL---IDIRDHVNKEIAMRLSTDIQSEDIFFTDLNG 904

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 96/301 (32%)
Alpha-mann_mid 359..434 CDD:214875 35/85 (41%)
Glyco_hydro_38C 483..973 CDD:285047 71/269 (26%)
man2a2NP_001006777.1 PLN02701 128..>906 CDD:178304 223/778 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.