DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and alpha-Man-IIb

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_001262614.1 Gene:alpha-Man-IIb FlyBaseID:FBgn0026616 Length:1249 Species:Drosophila melanogaster

Alignment Length:1129 Identity:286/1130 (25%)
Similarity:481/1130 (43%) Gaps:248/1130 (22%)


  Fly    38 VNIHLVPHSHNDVGWLKTVDQSYYGYKNKIHHAGVQYILDSVVSQLLQDPKRRFIQVETAFFAKW 102
            :.|.:|||||||.|||||. .:|:       .:..:.||:.:|:::.:.....||..|.:|...|
  Fly   168 LKIIVVPHSHNDPGWLKTF-TNYF-------QSDSRQILNLLVTKMQEYTDMTFIWSEISFLQLW 224

  Fly   103 WNVQSESMKKVVTKLVNEGRFEFTGGAWSMNDEANVNYQGVIDQFTVGLKFLNETFGSCGRPRVG 167
            |:....:.::.:.:|::.||.|.|.|.|.|.|||||:...::||...|.::|......  .|:||
  Fly   225 WDQAHPTKQRALKRLIDAGRIEITTGGWVMTDEANVHIYPMLDQLIEGHQWLKNNLNV--TPKVG 287

  Fly   168 WQIDTFGHSREQAAIFAHMGYDGQFFSRMDHNDKDTRMNDLTMEMIWDA-------SESMSGVSL 225
            |.||.|||......:.:...::|....|:.:..|.......:.:.||..       .:|.:|..|
  Fly   288 WSIDPFGHGSTVPYLLSGANFEGTIIQRIHYAWKQWFARQQSGDFIWKPYWRSRKDKDSEAGSLL 352

  Fly   226 FSGMLYNFYSDTPGFC----FDILCTDQPIIDGDSEENNVKQR--VDDFI---------SYAKNV 275
            ...|.::.|| ..|.|    |..|..|...|.|:..|.:||.:  .||.:         .||:..
  Fly   353 THNMPFDIYS-IKGSCGPHPFICLNFDFRKIPGEYTEYSVKAQFITDDNLESKAQLLLEQYARTA 416

  Fly   276 SEVYITNHIMVPMGGDFQY-EDAKVN--YKNMDKLIKYINERQASGSKYN--IFYSTPSCYLNSL 335
            | ::..|..::|:|.||:| :|.:|:  |:|..|||.:|   .|:...||  |.:.|||.|..::
  Fly   417 S-LFPHNVALIPVGDDFRYNKDREVDQQYQNYKKLIDHI---MANRRLYNADIRFGTPSDYFEAI 477

  Fly   336 HQSLE----SWPNKTQDFFPY----AHEKNSFWTGFFTSRPTQKRFERDGNHMLQVAKQLSVLAN 392
            .:.::    .:|....|||.|    :..:.::|:|:||:||..|....:..|.|:.|:.:..||.
  Fly   478 KERMKDHTPGFPTFKGDFFVYSDIFSEGRPAYWSGYFTTRPFYKLLSSELEHQLRSAEIVFTLAY 542

  Fly   393 LTSEEHK-------IDLDY-----LRQVMGVMQHHDAITGTEKQAVSDDYDRMMYEAIVGASNNA 445
            .|:.:.|       .:.:|     .|:.:|:.|||||||||.|.||..||...::|:........
  Fly   543 NTARQAKRENAIKIYEKNYELIINARRNLGLFQHHDAITGTSKAAVMRDYAMRLFESTQNMVKMQ 607

  Fly   446 RDALRLL--TNMP------YGEFESCLRLNISEC--------------------------AFTKD 476
            ...|.||  ...|      ..|||   |.|.::.                          ..:..
  Fly   608 ESCLELLLQKGQPRHHGFLLSEFE---RDNFNKLPRKMPIQMANGDESTPTVPAGEGGAGGSSSS 669

  Fly   477 GADNVLVTLYNPLAHSSTQYVRIPVKEENYQVTDEKGRTVPS-EVVPVPWQVLAL---------- 530
            |:....| |||.||....:.|.:.|:..|.::.::||..:.. ::.|| |.:...          
  Fly   670 GSVGSFV-LYNSLAQKRLEVVTLRVQHPNVKIVNDKGVELNHIQINPV-WNITDTYEQGLGTSVS 732

  Fly   531 ----EYRSNDTQHELVFKATVNKVSSYSIKKVESSEVK--------------HSSIKKINPRED- 576
                ..|::..|.|::|.|.:..: |.|..:|:..||.              .|....::|.|: 
  Fly   733 GTVGRIRTSTRQFEVMFVAELEPL-SLSTYRVQVDEVNFKRNIATIYCDDCTESQPASVSPPEEI 796

  Fly   577 NNSETVV-------------ENSVVKLVMDNHTGRLKSVEMNGVSEKIVQ------NFGVYKS-- 620
            .:|.|.|             ||..::|:.|..:|.||::......:::::      .|..|:|  
  Fly   797 ESSPTSVFEARGKPAGDIQLENPHMRLLFDEKSGFLKTITRKNQKKELLKPLQCNIKFAAYRSAQ 861

  Fly   621 -HTSCAYTFRQD-----GDIELFE--NDFEFTVYEGSLVKEVHQHVNDWISQVIRIYEGVSRV-- 675
             | |.||.|:.|     .:.|:.|  .|....:..|.:..:|......:::..:||:...:.:  
  Fly   862 FH-SGAYLFKTDPEQSEAEKEVLEGYTDMRIIITSGPIASDVTVIYGPFLAHTVRIFNTRTHLDA 925

  Fly   676 ------ELEWMVGPIPIDDKLGSEFVTN-------------FKSEISSN-----GVFYTDSNGRE 716
                  ::::...|...:.:|...||||             .|..:.:.     .|||:|.||.:
  Fly   926 AIYVENDIDFEPPPKNRETELFMRFVTNIDNIAQAPMQRDPLKEPVDAATMPELPVFYSDQNGFQ 990

  Fly   717 LMKRVKDKREDFVSDLSRQPVSGNFYPVTSRIALQDDTKRLVLLNDRSQGGASLEDGALEMLIHR 781
            ..:|:|         :....:.||::|:||...:||...||.||...:||.||.|.|.||:::.|
  Fly   991 YHERIK---------VPAIGIEGNYFPITSGAFIQDSRLRLTLLTTHAQGAASYEPGQLEVMLDR 1046

  Fly   782 RHLFNDGGGVGEALNETQYGKGLIARGKLYLILDSATDGDTVTERKTEKEL------------FL 834
            |.|::|..|:||.:.:::     :.|.|.:|:::....|..||:..:.|.|            :.
  Fly  1047 RTLYDDYRGMGEGVVDSR-----LTRHKFWLLVEDLPGGQHVTQPPSYKVLSQQAQQLANALRYP 1106

  Fly   835 PFWKFFSKTGGVEITPS-----KSLPDFNDLPQSVHLLTLEFFSEQEILIRFEHFLDKSEGRVIS 894
            |...|.|.....|:..:     :.||. ..||..|||.||...|:.|:.:    |...|...|:.
  Fly  1107 PNLYFVSNLEQPELAAALLPLVRLLPK-GPLPCDVHLTTLRTLSDPELQL----FPSASALLVLH 1166

  Fly   895 FNIRDIFD---SLGGLAIRETTLDGNMPLS-------DMKRFKFHAQESGTKPSSVEYSTAQHKP 949
               |..||   |.|    ||.:::...|||       .:.|...|..|:.:...:.:.|:.:...
  Fly  1167 ---RQGFDCSVSAG----RELSMEAICPLSSKGLGNVQLGRLSLHTIEATSLTGTEQKSSRESYH 1224

  Fly   950 LEAVKSDEASLFAVTLYPMQIRTF 973
            :.       ||..::|.||::|||
  Fly  1225 IR-------SLAEISLEPMELRTF 1241

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 89/298 (30%)
Alpha-mann_mid 359..434 CDD:214875 31/87 (36%)
Glyco_hydro_38C 483..973 CDD:285047 141/602 (23%)
alpha-Man-IIbNP_001262614.1 PLN02701 148..1246 CDD:178304 286/1130 (25%)
GH38N_AMII_GMII_SfManIII_like 167..514 CDD:212120 104/361 (29%)
Alpha-mann_mid 508..596 CDD:286360 31/88 (35%)
Glyco_hydro_38C 813..1241 CDD:285047 111/462 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64904799
eggNOG 1 0.900 E1_KOG1959
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001898
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11607
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.