DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and MAN2B1

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:XP_005259970.1 Gene:MAN2B1 HGNCID:6826 Length:1012 Species:Homo sapiens

Alignment Length:1013 Identity:413/1014 (41%)
Similarity:590/1014 (58%) Gaps:85/1014 (8%)


  Fly    10 LSILLVLFAKQSEAVCGYESCPETKANMVNIHLVPHSHNDVGWLKTVDQSYYGYKNKIHHAGVQY 74
            |...|:|.|.......|||:||..:.||:|:||:||:|:||||||||||.:||.||.|.||||||
Human    35 LCFFLLLLAAAGARAGGYETCPTVQPNMLNVHLLPHTHDDVGWLKTVDQYFYGIKNDIQHAGVQY 99

  Fly    75 ILDSVVSQLLQDPKRRFIQVETAFFAKWWNVQSESMKKVVTKLVNEGRFEFTGGAWSMNDEANVN 139
            |||||:|.||.||.||||.||.|||::||:.|:.:.::||..||.:||.||..|.|.|||||..:
Human   100 ILDSVISALLADPTRRFIYVEIAFFSRWWHQQTNATQEVVRDLVRQGRLEFANGGWVMNDEAATH 164

  Fly   140 YQGVIDQFTVGLKFLNETFGSCGRPRVGWQIDTFGHSREQAAIFAHMGYDGQFFSRMDHNDKDTR 204
            |..::||.|:||:||.:|||:.|||||.|.||.||||||||::||.||:||.||.|:|:.||..|
Human   165 YGAIVDQMTLGLRFLEDTFGNDGRPRVAWHIDPFGHSREQASLFAQMGFDGFFFGRLDYQDKWVR 229

  Fly   205 MNDLTMEMIWDASESMS--GVSLFSGMLYNFYSDTPGFCFDILCTDQPII-DGDSEENNVKQRVD 266
            |..|.||.:|.||.|:.  ...||:|:|.|.|:.....|:|:||.|||:: |..|.|.|.|:.||
Human   230 MQKLEMEQVWRASTSLKPPTADLFTGVLPNGYNPPRNLCWDVLCVDQPLVEDPRSPEYNAKELVD 294

  Fly   267 DFISYAKNVSEVYITNHIMVPMGGDFQYEDAKVNYKNMDKLIKYIN-ERQASGSKYNIFYSTPSC 330
            .|::.|......|.|||.::.||.|||||:|.:.:||:||||:.:| ::||.||..::.||||:|
Human   295 YFLNVATAQGRYYRTNHTVMTMGSDFQYENANMWFKNLDKLIRLVNAQQQAKGSSVHVLYSTPAC 359

  Fly   331 YLNSLHQSLESWPNKTQDFFPYAHEKNSFWTGFFTSRPTQKRFERDGNHMLQVAKQLSVLANLTS 395
            ||..|:::..:|..|..||||||...:.||||:|:|||..||:||...:.|||..||..|..|.:
Human   360 YLWELNKANLTWSVKHDDFFPYADGPHQFWTGYFSSRPALKRYERLSYNFLQVCNQLEALVGLAA 424

  Fly   396 EEHKI---DLDYLRQVMGVMQHHDAITGTEKQAVSDDYDRMM------YEAIVGASNNARDALRL 451
            .....   |...|.:.|.|:|||||::||.:|.|::||.|.:      .|.::   :||...||.
Human   425 NVGPYGSGDSAPLNEAMAVLQHHDAVSGTSRQHVANDYARQLAAGWGPCEVLL---SNALARLRG 486

  Fly   452 LTNMPYGEFESCLRLNISECAFTKDGADNVLVTLYNPLAHSSTQYVRIPVKEENYQVTDEKGRTV 516
            ..:    .|..|.:||||.|..::..| ...|.:||||.......||:||.|..:.|.|..||||
Human   487 FKD----HFTFCQQLNISICPLSQTAA-RFQVIVYNPLGRKVNWMVRLPVSEGVFVVKDPNGRTV 546

  Fly   517 PSEVVPVPWQVLALEYRSNDTQ-H--ELVFKATVNKV--SSYSIKKVESSEVKHSSIKKINPRED 576
            ||:||..|         |:|:| |  ||:|.|::..:  |:||:.:|...:.:..:.:.| ||..
Human   547 PSDVVIFP---------SSDSQAHPPELLFSASLPALGFSTYSVAQVPRWKPQARAPQPI-PRRS 601

  Fly   577 NNSETVVENSVVKLVMDNHTGRLKSVEMNGVSEKIV----QNFGVYKS--------HTSCAYTFR 629
            .:....:||..::...|..||.|  :|:..::::::    |.|..|.:        ..|.||.||
Human   602 WSPALTIENEHIRATFDPDTGLL--MEIMNMNQQLLLPVRQTFFWYNASIGDNESDQASGAYIFR 664

  Fly   630 QDGDIELFENDF-EFTVYEGSLVKEVHQHVNDWISQVIRIYEGVSRVELEWMVGPIPIDDKLGSE 693
            .:....|..:.: :..:.:..||:||||:.:.|.|||:|:|.|...:||||.|||||:.|..|.|
Human   665 PNQQKPLPVSRWAQIHLVKTPLVQEVHQNFSAWCSQVVRLYPGQRHLELEWSVGPIPVGDTWGKE 729

  Fly   694 FVTNFKSEISSNGVFYTDSNGRELMKRVKDKREDFVSDLSRQPVSGNFYPVTSRIALQDDTKRLV 758
            .::.|.:.:.:.|.|||||||||:::|.:|.|..:..: ..:||:||:|||.:||.:.|...:|.
Human   730 VISRFDTPLETKGRFYTDSNGREILERRRDYRPTWKLN-QTEPVAGNYYPVNTRIYITDGNMQLT 793

  Fly   759 LLNDRSQGGASLEDGALEMLIHRRHLFNDGGGVGEALNETQYGKGLIARGKLYLILDSATDGDTV 823
            :|.||||||:||.||:||:::|||.|.:||.||.|.|.|.  |.|...||:..::||:|......
Human   794 VLTDRSQGGSSLRDGSLELMVHRRLLKDDGRGVSEPLMEN--GSGAWVRGRHLVLLDTAQAAAAG 856

  Fly   824 TERKTEKELFLPFWKFFSKTGGVEI---TPSKSLPDFN----DLPQSVHLLTLEFFSEQEILIRF 881
            .....|:|:..| ....:..||...   .|.::  .|:    |||.|||||||..:..:.:|:|.
Human   857 HRLLAEQEVLAP-QVVLAPGGGAAYNLGAPPRT--QFSGLRRDLPPSVHLLTLASWGPEMVLLRL 918

  Fly   882 EH--FLDKSEGRVIS----FNIRDIFDSLGGLAIRETTLDGNMPLSDMKRFKFHAQESGTKPSSV 940
            ||  .:.:..||.:|    .|:||:|.:.....::||||..|.......|.|: ...:|..|...
Human   919 EHQFAVGEDSGRNLSAPVTLNLRDLFSTFTITRLQETTLVANQLREAASRLKW-TTNTGPTPHQT 982

  Fly   941 EYSTAQHKPLEAVKSDEASLFAVTLYPMQIRTFIIKTE 978
            .|           :.|.|:   :||.||:||||:...:
Human   983 PY-----------QLDPAN---ITLEPMEIRTFLASVQ 1006

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 152/276 (55%)
Alpha-mann_mid 359..434 CDD:214875 35/78 (45%)
Glyco_hydro_38C 483..973 CDD:285047 180/521 (35%)
MAN2B1XP_005259970.1 PLN02701 63..1001 CDD:178304 401/979 (41%)
GH38N_AMII_LAM_like 63..341 CDD:212121 153/278 (55%)
Alpha-mann_mid 388..466 CDD:214875 35/78 (45%)
Glyco_hydro_38C 511..1001 CDD:285047 180/523 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64883219
eggNOG 1 0.900 E1_KOG1959
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S4230
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D201312at2759
OrthoFinder 1 1.000 FOG0001898
OrthoInspector 1 1.000 T609335
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11607
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
109.760

Return to query results.
Submit another query.