DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and MAN2A1

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_002363.2 Gene:MAN2A1 HGNCID:6824 Length:1144 Species:Homo sapiens

Alignment Length:1065 Identity:286/1066 (27%)
Similarity:460/1066 (43%) Gaps:193/1066 (18%)


  Fly    27 YESCPETKANMVNIHLVPHSHNDVGWLKTVDQSYYGYKNKIHHAGVQYILDSVVSQLLQDPKRRF 91
            ||| .|.....:.:.:|||||||.|||||.: .|:..|       .|||.:::|.:|.:|.:|:|
Human   156 YES-NEWDTEPLQVFVVPHSHNDPGWLKTFN-DYFRDK-------TQYIFNNMVLKLKEDSRRKF 211

  Fly    92 IQVETAFFAKWWNVQSESMKKVVTKLVNEGRFEFTGGAWSMNDEANVNYQGVIDQFTVGLKFLNE 156
            |..|.::.:|||::.....|..|..|:..|:.|...|.|.|.|||..:|..:|||...|.::|..
Human   212 IWSEISYLSKWWDIIDIQKKDAVKSLIENGQLEIVTGGWVMPDEATPHYFALIDQLIEGHQWLEN 276

  Fly   157 TFGSCGRPRVGWQIDTFGHSREQAAIFAHMGYDGQFFSRMDHNDKDTRMNDLTMEMIWDASESMS 221
            ..|.  :||.||.||.||||...|.:....|.......|:.:..|.......|:|..|..:..:.
Human   277 NIGV--KPRSGWAIDPFGHSPTMAYLLNRAGLSHMLIQRVHYAVKKHFALHKTLEFFWRQNWDLG 339

  Fly   222 GVSLFSGMLYNFYS-DTPGFC---------FDIL--------C-------TDQPIIDGDSEENNV 261
            .|:.....:..||| |.|..|         ||..        |       |..|        .||
Human   340 SVTDILCHMMPFYSYDIPHTCGPDPKICCQFDFKRLPGGRFGCPWGVPPETIHP--------GNV 396

  Fly   262 KQRVDDFISYAKNVSEVYITNHIMVPMGGDF---QYEDAKVNYKNMDKLIKYINERQASGSKYNI 323
            :.|....:...:..|:::.|..::.|:|.||   :|.:..:.:||..:|..|:|.:  |..|..|
Human   397 QSRARMLLDQYRKKSKLFRTKVLLAPLGDDFRYCEYTEWDLQFKNYQQLFDYMNSQ--SKFKVKI 459

  Fly   324 FYSTPSCYLNSLHQSLESWPNKTQ--------DFFPYAHEKNSFWTGFFTSRPTQKRFERDGNHM 380
            .:.|.|.:.::|.::.|:..:|.|        |||.||...:.:|:|:|||||..||.:|.....
Human   460 QFGTLSDFFDALDKADETQRDKGQSMFPVLSGDFFTYADRDDHYWSGYFTSRPFYKRMDRIMESH 524

  Fly   381 LQVAKQLSVLANLTSEEHKID----------LDYLRQVMGVMQHHDAITGTEKQAVSDDY----- 430
            |:.|:.|...|...:.::||:          |...|:.:|:.|||||||||.|..|..||     
Human   525 LRAAEILYYFALRQAHKYKINKFLSSSLYTALTEARRNLGLFQHHDAITGTAKDWVVVDYGTRLF 589

  Fly   431 -DRMMYEAIVGASNNARDALRLLTNMPYGEF--ESCLRLNISECAFTKDGADNVL--------VT 484
             ..|:.|.|:|   |:...|.|...:.|..:  ::.|.:::.:.:.......|::        :.
Human   590 HSLMVLEKIIG---NSAFLLILKDKLTYDSYSPDTFLEMDLKQKSQDSLPQKNIIRLSAEPRYLV 651

  Fly   485 LYNPLAHSSTQYVRIPVKEENYQVTDEKGRTVPSEVVPVPWQVLALEYRSN---DTQHELVFKAT 546
            :||||.......|.:.|.....||....|:       ||..||.|:...:|   :|.:|:.|:|.
Human   652 VYNPLEQDRISLVSVYVSSPTVQVFSASGK-------PVEVQVSAVWDTANTISETAYEISFRAH 709

  Fly   547 VNKVSSYSIKKVES--------------SEVKHSSIKKINPREDNNSETVVENSVVKLVMDNHTG 597
            :..:.....|.:||              ::|:.|.|..|....:......:|||.|.|..| .||
Human   710 IPPLGLKVYKILESASSNSHLADYVLYKNKVEDSGIFTIKNMINTEEGITLENSFVLLRFD-QTG 773

  Fly   598 RLKSV--EMNGVSEKIVQNFGVY----KSHTSCAYTFRQDGDIELFENDFEFT------VYEGSL 650
            .:|.:  :.:|...::...|..|    |...|.||.|..||:.:    .:.:|      |..|.:
Human   774 LMKQMMTKEDGKHHEVNVQFSWYGTTIKRDKSGAYLFLPDGNAK----PYVYTTPPFVRVTHGRI 834

  Fly   651 VKEVHQHVNDWISQVIRIY--EGVSRVELEWMVGPIPIDDKLGSEFVTNFKSEISSNGVFYTDSN 713
            ..||.... |.::..:|:|  :|:....:| :...:.|......|......|:|.|...||||.|
Human   835 YSEVTCFF-DHVTHRVRLYHIQGIEGQSVE-VSNIVDIRKVYNREIAMKISSDIKSQNRFYTDLN 897

  Fly   714 GRELMKRVKDKREDFVSDLSRQPVSGNFYPVTSRIALQDDTKRLVLLNDRSQGGASLEDGALEML 778
            |.::..|:         .||:.|:..|.||:|:...:||...||.||:.:|.|.:||..|.:|::
Human   898 GYQIQPRM---------TLSKLPLQANVYPMTTMAYIQDAKHRLTLLSAQSLGVSSLNSGQIEVI 953

  Fly   779 IHRRHLFNDGGGVGEALNETQYGKGLIARGKLYLILDSATDGDTVTERKT--------------E 829
            :.||.:.:|..|:.:.:.:.:     |......::|:..:..:|..|:|:              .
Human   954 MDRRLMQDDNRGLEQGIQDNK-----ITANLFRILLEKRSAVNTEEEKKSVSYPSLLSHITSSLM 1013

  Fly   830 KELFLPFW-KFFSKTGGV--EITPSKSLPDFNDLPQSVHLLTLEFFSEQEILIRFEHFLDKSEGR 891
            ....:|.. ||.|.|..:  |.:|.:|     .||..:||:.|.....:   :...|   .:|..
Human  1014 NHPVIPMANKFSSPTLELQGEFSPLQS-----SLPCDIHLVNLRTIQSK---VGNGH---SNEAA 1067

  Fly   892 VI----SFNIRDIFDSLG-GLAIRETTLDGNMPLSDMKRFKFHAQESGTKPSSVEYSTAQHKPLE 951
            :|    .|:.|  |.|.| ||..  :|..|.:.:..:.. || ..||.| |||:   :..|.|  
Human  1068 LILHRKGFDCR--FSSKGTGLFC--STTQGKILVQKLLN-KF-IVESLT-PSSL---SLMHSP-- 1120

  Fly   952 AVKSDEASLFAVTLYPMQIRTFIIK 976
               ....::..:.|.||:|.||.|:
Human  1121 ---PGTQNISEINLSPMEISTFRIQ 1142

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 88/301 (29%)
Alpha-mann_mid 359..434 CDD:214875 33/91 (36%)
Glyco_hydro_38C 483..973 CDD:285047 135/543 (25%)
MAN2A1NP_002363.2 PLN02701 128..1144 CDD:178304 286/1066 (27%)
GH38N_Man2A1 165..508 CDD:212131 105/363 (29%)
Alpha-mann_mid 503..588 CDD:214875 32/85 (38%)
Glyco_hydro_38C 754..1139 CDD:285047 109/432 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.