DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and MAN2A2

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_001307906.1 Gene:MAN2A2 HGNCID:6825 Length:1175 Species:Homo sapiens

Alignment Length:1101 Identity:280/1102 (25%)
Similarity:459/1102 (42%) Gaps:249/1102 (23%)


  Fly    35 ANMVNIHLVPHSHNDVGWLKTVDQSYYGYKNKIHHAGVQYILDSVVSQLLQDPKRRFIQVETAFF 99
            |..:.:.:|||||||.||:||.|: ||..:       .|:||:|:||:|.:||:|||:..|.:||
Human   163 AEDLQVFVVPHSHNDPGWIKTFDK-YYTEQ-------TQHILNSMVSKLQEDPRRRFLWAEVSFF 219

  Fly   100 AKWWNVQSESMKKVVTKLVNEGRFEFTGGAWSMNDEANVNYQGVIDQFTVGLKFLNETFGSCGRP 164
            ||||:..:...:..|.:||..|:.|...|.|.|.||||.:|..:|||...|.::|....|:  .|
Human   220 AKWWDNINVQKRAAVRRLVGNGQLEIATGGWVMPDEANSHYFALIDQLIEGHQWLERNLGA--TP 282

  Fly   165 RVGWQIDTFGHSREQAAIFAHMGYDGQFFSRMDHNDKDTRMNDLTMEMIWDAS-ESMSGVSLFSG 228
            |.||.:|.||:|.....:............|:.:..|.......::|.:|..: :|.|...:|..
Human   283 RSGWAVDPFGYSSTMPYLLRRANLTSMLIQRVHYAIKKHFAATHSLEFMWRQTWDSDSSTDIFCH 347

  Fly   229 MLYNFYS-DTPGFCF---DILCT-DQPIIDGDS------------EENNVKQRVDDFISYAKNVS 276
            |: .||| |.|..|.   .|.|. |...:.|..            .|.||.:|....:...:..|
Human   348 MM-PFYSYDVPHTCGPDPKICCQFDFKRLPGGRINCPWKVPPRAITEANVAERAALLLDQYRKKS 411

  Fly   277 EVYITNHIMVPMGGDFQYE-----DAKVNYKNMDKLIKYINER-----QASGSKYNIFYSTPSCY 331
            :::.:|.::||:|.||:|:     ||:  :.|..:|..:.|.|     ||.       :.|.|.|
Human   412 QLFRSNVLLVPLGDDFRYDKPQEWDAQ--FFNYQRLFDFFNSRPNLHVQAQ-------FGTLSDY 467

  Fly   332 LNSLHQSL--------ESWPNKTQDFFPYAHEKNSFWTGFFTSRPTQKRFERDGNHMLQVAKQLS 388
            .::|::..        ..:|..:.|||.||..::.:|||::||||..|..:|.....|:.|:.|.
Human   468 FDALYKRTGVEPGARPPGFPVLSGDFFSYADREDHYWTGYYTSRPFYKSLDRVLEAHLRGAEVLY 532

  Fly   389 VLA-------NLTSEEHKIDLDYL---RQVMGVMQHHDAITGTEKQAVSDDYDRMMYEAIVGASN 443
            .||       .|.......|...|   |:.:|:.|||||||||.|:||..||...:..::|....
Human   533 SLAAAHARRSGLAGRYPLSDFTLLTEARRTLGLFQHHDAITGTAKEAVVVDYGVRLLRSLVNLKQ 597

  Fly   444 ---NARDALRLLTNMPYGEFESCLRLNISECAFTKDG----------ADNVLVTLYNPLAHSSTQ 495
               :|...|.|.....|........|.:.:...:.|.          :....|.|:|||......
Human   598 VIIHAAHYLVLGDKETYHFDPEAPFLQVDDTRLSHDALPERTVIQLDSSPRFVVLFNPLEQERFS 662

  Fly   496 YVRIPVKEENYQVTDEKGRTV----------PSEVVPVPWQV-----------------LALE-Y 532
            .|.:.|.....:|..|:|:.:          .:|.||..:||                 |.|: :
Human   663 MVSLLVNSPRVRVLSEEGQPLAVQISAHWSSATEAVPDVYQVSVPVRLPALGLGVLQLQLGLDGH 727

  Fly   533 RSNDTQHELVF---KATVNKVSSYSIKKVESSEVKHSSIKKINPREDNNSETVVENSVVKLVMDN 594
            |:..:...:..   :.:|::..::.::.::|                ..|:..:.|..:::....
Human   728 RTLPSSVRIYLHGRQLSVSRHEAFPLRVIDS----------------GTSDFALSNRYMQVWFSG 776

  Fly   595 HTGRLKSVEMNGVSEKIVQNFG----VYKSHT----SCAYTFRQDGDIELF--ENDFEFTVYEGS 649
            .||.|||:..  |.|:..|...    ||.:.|    |.||.|..||:.:.:  :......|.||.
Human   777 LTGLLKSIRR--VDEEHEQQVDMQVLVYGTRTSKDKSGAYLFLPDGEAKPYVPKEPPVLRVTEGP 839

  Fly   650 LVKEV---HQHVNDWISQVIRIYE--GVSRVELEWMVGPIPIDDKLGSEFVTNFKSEISSNGVFY 709
            ...||   ::|::    |.:|:|.  ||..:.|: :...:.|.|.:..|...:..::|.|.|:|:
Human   840 FFSEVVAYYEHIH----QAVRLYNLPGVEGLSLD-ISSLVDIRDYVNKELALHIHTDIDSQGIFF 899

  Fly   710 TDSNGRELMKRVKDKREDFVSDLSRQPVSGNFYPVTSRIALQDDTKRLVLLNDRSQGGASLEDGA 774
            ||.||.::..|         ..|.:.|:..||||:.....:||..|||.|...::.|.:||:||.
Human   900 TDLNGFQVQPR---------RYLKKLPLQANFYPMPVMAYIQDAQKRLTLHTAQALGVSSLKDGQ 955

  Fly   775 LEMLIHRRHLFNDGGGVGEALNETQYGKGLIARGKLYLILDSATDGDTVTERKTEKELFLPFWKF 839
            ||:::.||.:.:|..|:|:.|.:.:.     ...:..|:|:..|.|       :|.:.|......
Human   956 LEVILDRRLMQDDNRGLGQGLKDNKR-----TCNRFRLLLERRTVG-------SEPDFFSKLAAM 1008

  Fly   840 F-------SKTGGVEITPSKSL-------------------------------------PDFNDL 860
            |       |::|..|:..|.|.                                     |..:.|
Human  1009 FRGLIFHSSRSGNREVQDSHSTSYPSLLSHLTSMYLNAPALALPVARMQLPGPGLRSFHPLASSL 1073

  Fly   861 PQSVHLLTLEFFSEQE---------ILIRFEHFLDKSEGRVISFNIRDIFDSLGGLAIRETTLDG 916
            |...|||.|.....:|         :::..:.|....|.:.:.||.              ||..|
Human  1074 PCDFHLLNLRTLQAEEDTLPSAETALILHRKGFDCGLEAKNLGFNC--------------TTSQG 1124

  Fly   917 NMPLSDMKRFKFHAQE-SGTKPSSVEYSTAQHKPLEAVKSDEASLFAVTLYPMQIRTFIIK 976
            .:.|..:    ||..: ...:|:|:   |..: || |..|:...::   |.||:|.||.::
Human  1125 KVALGSL----FHGLDVVFLQPTSL---TLLY-PL-ASPSNSTDVY---LEPMEIATFRLR 1173

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 94/296 (32%)
Alpha-mann_mid 359..434 CDD:214875 33/85 (39%)
Glyco_hydro_38C 483..973 CDD:285047 130/590 (22%)
MAN2A2NP_001307906.1 PLN02701 136..1174 CDD:178304 280/1102 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.