DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and alpha-Man-IIa

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_001262413.1 Gene:alpha-Man-IIa FlyBaseID:FBgn0011740 Length:1109 Species:Drosophila melanogaster

Alignment Length:891 Identity:237/892 (27%)
Similarity:394/892 (44%) Gaps:200/892 (22%)


  Fly    27 YESCPETKANMVNIHLVPHSHNDVGWLKTVDQSYYGYKNKIHHAGVQYILDSVVSQLLQDPKRRF 91
            |:.......:.:.:.:|||||||.||::|.:: ||.:..|       :||.:.:..|..:|:.:|
  Fly   134 YDPLKYNAHHKLKVFVVPHSHNDPGWIQTFEE-YYQHDTK-------HILSNALRHLHDNPEMKF 190

  Fly    92 IQVETAFFAKWWNVQSESMKKVVTKLVNEGRFEFTGGAWSMNDEANVNYQGVIDQFTVG---LK- 152
            |..|.::||::::...|:.|..:..:|..|:.||..|.|.|.||||.:::.|:.|.|.|   || 
  Fly   191 IWAEISYFARFYHDLGENKKLQMKSIVKNGQLEFVTGGWVMPDEANSHWRNVLLQLTEGQTWLKQ 255

  Fly   153 FLNETFGSCGRPRVGWQIDTFGHSREQAAIFAHMGYDGQFFSRMDHNDKDTRMNDLTMEMIW-DA 216
            |:|.|      |...|.||.||||.....|....|:......|..::.|........:|.:| ..
  Fly   256 FMNVT------PTASWAIDPFGHSPTMPYILQKSGFKNMLIQRTHYSVKKELAQQRQLEFLWRQI 314

  Fly   217 SESMSGVSLFSGMLYNFYS-DTPGFC-----------------FDILC---------TDQPIIDG 254
            .::....:||:.|: .||| |.|..|                 |.:.|         :||     
  Fly   315 WDNKGDTALFTHMM-PFYSYDIPHTCGPDPKVCCQFDFKRMGSFGLSCPWKVPPRTISDQ----- 373

  Fly   255 DSEENNVKQRVDDFISYAKNVSEVYITNHIMVPMGGDFQYED------AKVNYKNMDKLIKYINE 313
                 ||..|.|..:...|..:|:|.||.:::|:|.||:::.      .:|||   ::|.::|| 
  Fly   374 -----NVAARSDLLVDQWKKKAELYRTNVLLIPLGDDFRFKQNTEWDVQRVNY---ERLFEHIN- 429

  Fly   314 RQASGSKYNI--FYSTPSCYLNSLHQSLES----WPNKTQDFFPYAHEKNSFWTGFFTSRPTQKR 372
               |.:.:|:  .:.|...|.:::||:..:    :|..:.|||.||...:::|:|::||||..||
  Fly   430 ---SQAHFNVQAQFGTLQEYFDAVHQAERAGQAEFPTLSGDFFTYADRSDNYWSGYYTSRPYHKR 491

  Fly   373 FERDGNHMLQVAKQLSV------LANLTSEEHKIDLDYLRQVMGVMQHHDAITGTEKQAVSDDYD 431
            .:|...|.::.|:.||.      :|.:  ||.   |:..|:.:.:.||||.||||.|..|..||:
  Fly   492 MDRVLMHYVRAAEMLSAWHSWDGMARI--EER---LEQARRELSLFQHHDGITGTAKTHVVVDYE 551

  Fly   432 RMMYEAIVGASNNARDAL-RLLTNMPYGEFESCLRLNISECAFTKDGA----------------- 478
            :.|.||:.......:.:: ||||.      .|....:.|...||.|.:                 
  Fly   552 QRMQEALKACQMVMQQSVYRLLTK------PSIYSPDFSFSYFTLDDSRWPGSGVEDSRTTIILG 610

  Fly   479 DNVL----VTLYNPLAHSSTQYVRIPVKEENYQVTDEKGRTVPSEVVPV-PWQ----VLALEYRS 534
            :::|    |.::|.|.|...|.|...|......|||.....|.::|.|| .|.    ...:..:.
  Fly   611 EDILPSKHVVMHNTLPHWREQLVDFYVSSPFVSVTDLANNPVEAQVSPVWSWHHDTLTKTIHPQG 675

  Fly   535 NDTQHELVFKATVNK--VSSYSIKKVESSEVKHSS----------------------IKKINPRE 575
            :.|::.::|||.|..  :::| :..:..|:.:|:|                      :|..:|||
  Fly   676 STTKYRIIFKARVPPMGLATY-VLTISDSKPEHTSYASNLLLRKNPTSLPLGQYPEDVKFGDPRE 739

  Fly   576 DN----NSETVVENSVVKLVMDNHTGRLKSVEMNGVSEKIVQNF-----GVYKSH--TSCAYTFR 629
            .:    |..|:.         .:..|.|||:::...|..:..:|     || :||  .|.||.|.
  Fly   740 ISLRVGNGPTLA---------FSEQGLLKSIQLTQDSPHVPVHFKFLKYGV-RSHGDRSGAYLFL 794

  Fly   630 QDG---DIEL-------FENDFEFTVYEGSLVKEVHQHVNDWISQVIRIYEGVSRVELEWMVGPI 684
            .:|   .:||       .:...|.:|..| |...|||.:....:..||....:..::        
  Fly   795 PNGPASPVELGQPVVLVTKGKLESSVSVG-LPSVVHQTIMRGGAPEIRNLVDIGSLD-------- 850

  Fly   685 PIDDKLGSEFVTNFKSEISSNGVFYTDSNGRELMKRVKDKREDFVSDLSRQPVSGNFYPVTSRIA 749
                  .:|.|...::.|.|..:||||.||.:.:||.:         |.:.|:..|:||:.|.:.
  Fly   851 ------NTEIVMRLETHIDSGDIFYTDLNGLQFIKRRR---------LDKLPLQANYYPIPSGMF 900

  Fly   750 LQDDTKRLVLLNDRSQGGASLEDGALEMLIHRRHLFNDGGGVGEAL 795
            ::|...||.||..:..||:||..|.||::..||...:|..|:|:.:
  Fly   901 IEDANTRLTLLTGQPLGGSSLASGELEIMQDRRLASDDERGLGQGV 946

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 89/311 (29%)
Alpha-mann_mid 359..434 CDD:214875 30/81 (37%)
Glyco_hydro_38C 483..973 CDD:285047 91/364 (25%)
alpha-Man-IIaNP_001262413.1 GH38N_AMII_GMII_SfManIII_like 144..483 CDD:212120 104/371 (28%)
Alpha-mann_mid 478..554 CDD:214875 30/81 (37%)
Glyco_hydro_38C 744..1103 CDD:285047 63/238 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64904846
eggNOG 1 0.900 E1_KOG1959
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11607
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.