DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and Man2b1

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:XP_017456800.1 Gene:Man2b1 RGDID:3039 Length:1046 Species:Rattus norvegicus

Alignment Length:975 Identity:393/976 (40%)
Similarity:559/976 (57%) Gaps:77/976 (8%)


  Fly     7 ILFLSILL-VLFAKQSEAVCGYESCPETKANMVNIHLVPHSHNDVGWLKTVDQSYYG-------- 62
            :|.:|.|: :|.|.......||::||.||..|:|:||:||:|:||||||||||.|||        
  Rat    31 VLSISFLIWLLLAAPGAQAAGYKTCPTTKPGMLNVHLLPHTHDDVGWLKTVDQYYYGMDPHLLTF 95

  Fly    63 ---YKNKIHHAGVQYILDSVVSQLLQDPKRRFIQVETAFFAKWWNVQSESMKKVVTKLVNEGRFE 124
               ..:.:.||.||||||||:..||.||.||||.||.|||::||..|:...:..|..||.:||.|
  Rat    96 MPIVMSDVQHASVQYILDSVIYSLLNDPTRRFIYVEMAFFSRWWKQQTNVTQDAVRNLVRQGRLE 160

  Fly   125 FTGGAWSMNDEANVNYQGVIDQFTVGLKFLNETFGSCGRPRVGWQIDTFGHSREQAAIFAHMGYD 189
            |..|.|.|||||..:|..::||.|:||:||.:||||.|.|||.|.||.||||||||::||.||:|
  Rat   161 FVNGGWVMNDEAATHYGAIVDQMTLGLRFLQDTFGSDGLPRVAWHIDPFGHSREQASLFAQMGFD 225

  Fly   190 GQFFSRMDHNDKDTRMNDLTMEMIWDASESMS--GVSLFSGMLYNFYSDTPGFCFDILCTDQPII 252
            |.|..|:|:.||..|...|.||.:|.||.|:.  ...||:|:|.|.|:.....|:|:||||.|::
  Rat   226 GFFLGRIDYQDKFNRKRKLKMEELWRASASLKPPAADLFTGVLPNNYNPPKDLCWDVLCTDPPVV 290

  Fly   253 DG-DSEENNVKQRVDDFISYAKNVSEVYITNHIMVPMGGDFQYEDAKVNYKNMDKLIKYINE-RQ 315
            |. .|.|.|..:.||.|::.|.:..:.|.|||.::.||.|||||:|.:.:|||||||:.:|| :|
  Rat   291 DDPTSPEFNANKLVDYFLNLASSQKKYYRTNHTVMTMGSDFQYENANMWFKNMDKLIRLVNEQQQ 355

  Fly   316 ASGSKYNIFYSTPSCYLNSLHQSLESWPNKTQDFFPYAHEKNSFWTGFFTSRPTQKRFERDGNHM 380
            |:|||.::.||||||||..|:::..:|..|..||||||...:.||||:|:|||..||:||...:.
  Rat   356 ANGSKVHVLYSTPSCYLWELNKANLTWTVKEDDFFPYADGPHMFWTGYFSSRPALKRYERLSYNF 420

  Fly   381 LQVAKQLSVLANLTSEEHKI------DLDYLRQVMGVMQHHDAITGTEKQAVSDDYDRMM----- 434
            |||..||..   |...|.|:      |...|.:.|.|:|||||:|||.:|.|.:||.:.:     
  Rat   421 LQVCNQLEA---LVGPEAKVGPYGSGDSAPLNEAMAVLQHHDAVTGTARQNVVNDYAKQLAAGWG 482

  Fly   435 -YEAIVGASNNARDALRLLTNMPYGEFESCLRLNISECAFTKDGADNVLVTLYNPLAHSSTQYVR 498
             .|.:|   :||...|.|...    .|..|..:|||.|..::. :::..|.:|||:.......||
  Rat   483 PCEVLV---SNALARLSLYKQ----NFSFCREINISICPASQT-SEHFRVIIYNPVGRKVDLMVR 539

  Fly   499 IPVKEENYQVTDEKGRTVPSEVVPVPWQVLALEYRSNDTQHELVFKATVNKV--SSYSIKKVESS 561
            :||.|..:.|.|...|.:.|.||.||      ...|...|.||:|.|:|..:  |.||:.|:...
  Rat   540 LPVSEGIFLVKDPNDRRISSNVVMVP------SAYSKTYQWELLFPASVPALGFSIYSVNKMSGH 598

  Fly   562 EVKHSSIKKINPREDNNSETVVENSVVKLVMDNHTGRLKSVE--MNGVSEKIVQNFGVYKS---- 620
            ..:..:: ...|::..:...|:||..::...|:.||.|:.:|  ...:|..:.|.|..|.:    
  Rat   599 NHQAHNL-TARPKKSKSRVLVIENKYIRATFDSDTGLLRKIENLEQNISLPVRQGFFWYNASAGD 662

  Fly   621 ----HTSCAYTFRQDGDIELFENDF-EFTVYEGSLVKEVHQHVNDWISQVIRIYEGVSRVELEWM 680
                ..|.||.||......|..:.: :.|:.:.:||:||||:.:.|.|||||:|||...:||||.
  Rat   663 EESPQASGAYIFRPSHRKPLPVSHWAQVTLVKTNLVQEVHQNFSAWCSQVIRLYEGQRHLELEWT 727

  Fly   681 VGPIPIDDKLGSEFVTNFKSEISSNGVFYTDSNGRELMKRVKDKREDFVSDLSRQPVSGNFYPVT 745
            |||||:.|..|.|.::.|.:.:.:.|.|:|||||||::||..|.|..:..: ..:||:||:|||.
  Rat   728 VGPIPVKDDWGKEVISRFNTPMRTRGQFFTDSNGREILKRRDDFRPTWTLN-QTEPVAGNYYPVN 791

  Fly   746 SRIALQDDTKRLVLLNDRSQGGASLEDGALEMLIHRRHLFNDGGGVGEALNETQYGKGLIARGKL 810
            :||.:.|...:|.:|.||||||:||.||:||:::|||.|.:|..||.|.|.||..|..:  ||:.
  Rat   792 TRIYITDGHMQLTVLTDRSQGGSSLLDGSLELMVHRRLLVDDERGVAEPLLETDTGDKV--RGRH 854

  Fly   811 YLILDSATDGDTVTERKTEKELFLPFWKFFSKTGGVEITPSKSLPDF------NDLPQSVHLLTL 869
            .:||.|.:|.........|:|:..|  :.....||.....|:: |..      .:||..||||||
  Rat   855 LVILSSVSDAAARHRLLAEQEVLAP--QVVLAHGGSSPYHSQA-PKMQFSALRRELPPQVHLLTL 916

  Fly   870 EFFSEQEILIRFEH-FLDKSEGR-----VISFNIRDIFDSLGGLAIRETTLDGNMPLSDMKRFKF 928
            ..:..:.:|:|.|| |..|.:..     .::.|::::|.:.....::||||..|.|||.:.|.|:
  Rat   917 ARWGPKMLLLRLEHQFAVKEDSNRNLSSPVTLNLQNLFKTFTINYLQETTLAANQPLSRVSRLKW 981

  Fly   929  928
              Rat   982  981

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 145/287 (51%)
Alpha-mann_mid 359..434 CDD:214875 36/81 (44%)
Glyco_hydro_38C 483..973 CDD:285047 164/472 (35%)
Man2b1XP_017456800.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64849886
eggNOG 1 0.900 E1_KOG1959
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D201312at2759
OrthoFinder 1 1.000 FOG0001898
OrthoInspector 1 1.000 T618275
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11607
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
98.810

Return to query results.
Submit another query.