DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and Man2b2

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_001128443.1 Gene:Man2b2 RGDID:1308840 Length:1004 Species:Rattus norvegicus

Alignment Length:1073 Identity:273/1074 (25%)
Similarity:461/1074 (43%) Gaps:228/1074 (21%)


  Fly    35 ANMVNIHLVPHSHNDVGWLKTVDQSYYGYKNKIHHAGVQYILDSVVSQLLQDPKRRFIQVETAFF 99
            |:.:...:|||||.||||:.||.:|...|...::        .:||.:|::..:||||.||..||
  Rat    24 ASPIRAFVVPHSHMDVGWVYTVQESMRAYAANVY--------TTVVEELVRGRQRRFIAVEQEFF 80

  Fly   100 AKWWN-VQSESMKKVVTKLVNEGRFEFTGGAWSMNDEANVNYQGVIDQFTVGLKFLNETFGSCGR 163
            ..||: |.||..|:.|.:|::||..||..|...|:|||..:....|.|.|.|..||.||||.  |
  Rat    81 RLWWDGVASEQQKQQVRQLLDEGCLEFVLGGQVMHDEAVTHLDDQILQLTEGHGFLYETFGI--R 143

  Fly   164 PRVGWQIDTFGHSREQAAIFAHMGYDGQFFSRMDHNDKDTRMNDLTMEMIWDASESMS-GVSLFS 227
            |:..|.:|.||.|.....:|:..|::....||:|::.||.......::.:|..|.|:| ...:::
  Rat   144 PQFSWHVDPFGASATTPTLFSLAGFNAHLISRIDYDLKDAMQEAQGLQFVWHGSPSLSEQQEIYT 208

  Fly   228 GM--LYNF-------YSDTPGFCFD-ILCTDQPIIDGDSEENNVKQRVDDFISYAK----NVSE- 277
            .:  ||::       :|:..||.:: :....:|..||.....:....||:...||:    |:.: 
  Rat   209 HVMDLYSYCTPSHIPFSNRSGFYWNGVAVFPEPPPDGVYPNMSEPVTVDNIHLYAEALVANIKQR 273

  Fly   278 --VYITNHIMVPMGGDFQYEDAKVNYKNMDKLIKYINERQASGSKYNIFYSTPSCYLNSLHQSLE 340
              .:.|.|::.|.|.|.|:.:|.|.:.|||.|::|||.|.|... .::.|:|.:.|..:||....
  Rat   274 AAWFRTPHVLWPWGCDKQFFNASVQFDNMDPLLEYINNRSAQFG-ISVQYATLNDYFQALHDFNV 337

  Fly   341 SWPNKT-QDFFPYAHEKNSFWTGFFTSRPTQKRFERDGNHMLQVAKQLSVLANLTSEEHKID--- 401
            :|..:. .||.||:.|....||||:|||.|.|...|..:.:|...:.:............:|   
  Rat   338 TWDIRDHHDFLPYSSEPQQAWTGFYTSRSTLKGLARQASALLYAGESMFTRYMWPHPRGTLDPTW 402

  Fly   402 ----LDYLRQVMGVMQHHDAITGTEKQAVSDDYDRMMYEAIVGASNNARDALRLLTNMPYGEFES 462
                |..||..:..:||||||||||...|.:.|...:       |...|...:|:.:        
  Rat   403 ALQQLQQLRWAVSEVQHHDAITGTESPKVKNMYMEHL-------SMGMRGVHKLMAS-------- 452

  Fly   463 CLRLNISECAFTKDGADNVLVTLYNPLAHSSTQYVRIPVKEENYQVTDEKGRTVPSEVVPVPWQV 527
             :.|:.|..:.|.........::|||||...|..:.:.|...:..||||.||.|.:::       
  Rat   453 -IALDRSPGSGTDTRPVGYSASVYNPLAWKITTIITLTVAFPSVSVTDELGRPVSAQI------- 509

  Fly   528 LALEYRSNDTQ----HELVFKATVNKVS--SYSIKKV-------------ESSEVKHSSIKKINP 573
                  .|.|:    ::|:...|:..:|  .|.::::             .::.:|.|...:...
  Rat   510 ------QNSTKDPSAYDLLILTTIPGLSYRYYKVRRILGDQAGTRELVTPRANTLKFSRKLRNQT 568

  Fly   574 REDNNSETVVENSVVKLVMDNHTGRLKSVE--MNGVSEKIVQNFGVYKSHTSCAYTFRQDGDIE- 635
            .::......|.|....|:.|..|..|.|::  .:..:..:.|.|          ..:|.:||:: 
  Rat   569 SQEGKLLVPVMNDCYTLLFDQDTNMLHSIQDRQSNRTVHMTQEF----------LEYRANGDVKQ 623

  Fly   636 -------LF-ENDFEFTVYE--------GSLVKEVHQH----VND--WI----SQVIRIYEGVS- 673
                   || .||.....:|        |:|..:|.|:    :.|  :|    :::..::..:: 
  Rat   624 GPISDNYLFASNDTAEPSWEAVGMEMVVGTLATDVRQYFYRNITDQGYIYSIHTRLAHVHPSLAG 688

  Fly   674 -----RVELEWMVGPIPIDDKLGSEFVTNFKSEISSNGVFYTDSNGRELMKRVKDKREDFVSDLS 733
                 |:|.::.|||:    .|..|.:....|:::|..|.|:|:||.::.:|   ..:.|.|:  
  Rat   689 ELLCRRIEQQYQVGPL----DLNREAILRTSSDLNSQQVLYSDNNGYQMQRR---PYKAFKSN-- 744

  Fly   734 RQPVSGNFYPVTSRIALQDDTKRLVLLNDRSQGGASLEDGALEMLIHRRHLFND---GGGVGEAL 795
              |:..|:||:.....::||..|||||.:|..|.:|.|:|.:|:::||| |:|:   .......|
  Rat   745 --PIPRNYYPMVQSAFIEDDKSRLVLLAERPHGVSSQENGQVEVMLHRR-LWNNLVWDLNYNLTL 806

  Fly   796 NETQYGKGLIARGKLYLILDSATDGDTVTERKTEKELFLPFWKFFSKTGGVEI--TPSKSLPDFN 858
            |:|.     :....|:|:|...:....:..|                 .||.:  .|...|.:..
  Rat   807 NDTS-----VVHPVLWLLLGPKSTTTALRPR-----------------SGVALQHRPVVLLKELT 849

  Fly   859 D----------------LPQSVHLLTLEF----FSE---------------------QEILIRFE 882
            |                ||.|:||..|..    :|.                     |.:|:|..
  Rat   850 DEEETAIHRPHHPWPVTLPPSLHLQVLSLRGWQYSRNHAQHLKNLQRGHPEKPQVNLQRVLLRLH 914

  Fly   883 HFLDKSEGRVIS----FNIRDIFDSLGG-LAIRETTLDGNMPLSDMKRFKFHAQESGTKPSSVEY 942
            |..:..|..|:|    .:::.....||. :|:.|.:|.|...:..::|:.:..:....|      
  Rat   915 HLYEAGEDPVLSRPATVDLKIALRGLGSVVAVEERSLTGTWDVQTLQRWHWRTKIGQLK------ 973

  Fly   943 STAQHKPLEAVKSDEASLFAVTLYPMQIRTFII 975
                ..|....:|...|:  :|:||.:||||.|
  Rat   974 ----GHPTSPPRSPGGSI--ITVYPKEIRTFFI 1000

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 96/292 (33%)
Alpha-mann_mid 359..434 CDD:214875 27/82 (33%)
Glyco_hydro_38C 483..973 CDD:285047 127/595 (21%)
Man2b2NP_001128443.1 GH38N_AMII_Epman_like 27..352 CDD:212122 109/336 (32%)
Alpha-mann_mid 358..439 CDD:214875 27/81 (33%)
Glyco_hydro_38C 474..998 CDD:285047 127/593 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D201312at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11607
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.