DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and LManII

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_609408.1 Gene:LManII FlyBaseID:FBgn0027611 Length:1080 Species:Drosophila melanogaster

Alignment Length:1073 Identity:498/1074 (46%)
Similarity:670/1074 (62%) Gaps:113/1074 (11%)


  Fly     4 LGRILFLSILLVLFAKQSEAVCGYESCPETKANMVNIHLVPHSHNDVGWLKTVDQSYYGYKNKIH 68
            ||.::..:.|..:..|.|:  |||:||..||.||:|:|||.|:|:||||||||||.|||.:.||.
  Fly    15 LGCLIHDADLRSIQPKASQ--CGYQSCHPTKPNMLNVHLVAHTHDDVGWLKTVDQYYYGSETKIQ 77

  Fly    69 HAGVQYILDSVVSQLLQDPKRRFIQVETAFFAKWWNVQSESMKKVVTKLVNEGRFEFTGGAWSMN 133
            .||||||:||||..||:||::|||.||:|||.|||..|...:::.|..||.:||.||.|||||||
  Fly    78 KAGVQYIIDSVVEALLRDPEKRFIYVESAFFFKWWKEQKPKVQEAVKMLVEQGRLEFIGGAWSMN 142

  Fly   134 DEANVNYQGVIDQFTVGLKFLNETFGSCGRPRVGWQIDTFGHSREQAAIFAHMGYDGQFFSRMDH 198
            |||..:||.|||||:.||:.||:|||.|||||||||||.||||||.|::||.||:||.||.|:|:
  Fly   143 DEATTHYQSVIDQFSWGLRLLNDTFGECGRPRVGWQIDPFGHSREMASMFAQMGFDGMFFGRLDY 207

  Fly   199 NDKDTRMNDLTMEMIWDASESM-SGVSLFSGMLYNFYSDTPGFCFDILCTDQPIIDG-DSEENNV 261
            .|||.|:.....||||..|.:: ....||||.|||.|....||||||||.|.||||| .|.:|||
  Fly   208 QDKDERLMTKNAEMIWHGSANLGEEADLFSGALYNNYQAPDGFCFDILCNDAPIIDGKHSPDNNV 272

  Fly   262 KQRVDDFISYAKNVSEVYITNHIMVPMGGDFQYEDAKVNYKNMDKLIKYINERQASGSKYNIFYS 326
            |:|:|.|:.:||..|:.|.||:|:|.|||||.|:.|:|.|||:||||:|.|||||:||..|:.||
  Fly   273 KERIDTFLDFAKTQSQYYRTNNIIVTMGGDFTYQAAQVYYKNLDKLIRYGNERQANGSNINLLYS 337

  Fly   327 TPSCYLNSLHQSLESWPNKTQDFFPYAHEKNSFWTGFFTSRPTQKRFERDGNHMLQVAKQLSVLA 391
            ||||||.|||.:..:||.|:.||||||.:.:::|||:||||||.|||||||||.|||.||||.||
  Fly   338 TPSCYLKSLHDAGITWPTKSDDFFPYASDPHAYWTGYFTSRPTLKRFERDGNHFLQVCKQLSALA 402

  Fly   392 NLTSEEHKIDLDYLRQVMGVMQHHDAITGTEKQAVSDDYDRMMYEAIVGASNNARDALRLL---- 452
            ....||....|.::|:.:|:||||||||||||:.|:.||.:.|..|........|:||..|    
  Fly   403 PKKPEEFDPHLTFMRETLGIMQHHDAITGTEKEKVALDYAKRMSVAFRACGATTRNALNQLTVQS 467

  Fly   453 ------TNMPY-GEFESCLRLNISECAFTKDGADNVLVTLYNPLAHSSTQYVRIPVKEENYQVTD 510
                  |:..| .||::|..|||:.|. ..:..|...:||||||||:..:||||||...||::.|
  Fly   468 KDNVKDTSAKYVFEFKTCALLNITSCP-VSEANDRFALTLYNPLAHTVNEYVRIPVPYSNYRIID 531

  Fly   511 EKGRTVPSEVVPVPWQVLALEYRSNDTQHELVFKAT---VNKVSSYSIKKVESSEVKHSSIKKIN 572
            .||.|:.|:.||:|..::.:::|::..::|:||.||   .....:|.::|::|:|....|  |..
  Fly   532 NKGVTLESQAVPIPQVLIDIKHRNSTAKYEIVFLATNIPALGYRTYYVEKLDSTEGNTRS--KAL 594

  Fly   573 PREDNNSETVVENSVVKLVMDNHTGRLKSVEMNGVSEKIVQNFGVYK----------SHTSCAYT 627
            |:. .:|.||:.||.::|..|.: |.|..|..:|::..:.|.|..|:          :.:|.||.
  Fly   595 PKR-TSSVTVIGNSHIQLGFDTN-GFLSEVTADGLTRLVSQEFLFYEGAVGNNAEFLNRSSGAYI 657

  Fly   628 FR-QDGDIELFENDFEFTVYEGSLVKEVHQHVNDWISQVIRIYEGVSRVELEWMVGPIPIDDKLG 691
            || .:..|....:..|..||:|.||.||||..|||||||:|:|...|..|.||:||||||||.:|
  Fly   658 FRPNENKIHFATDQVEIEVYKGDLVHEVHQKFNDWISQVVRVYNKDSYAEFEWLVGPIPIDDGIG 722

  Fly   692 SEFVTNFKSEISSNGVFYTDSNGRELMKRVKDKREDFVSDLSRQPVSGNFYPVTSRIALQDDTKR 756
            .|.:|.|.|:|:|:|:|.|||||||::|| |....|..|....:.|:||:||:|::|.::|||.|
  Fly   723 KEVITRFNSDIASDGIFRTDSNGREMIKR-KINHRDTWSVKINEAVAGNYYPITTKIDVEDDTAR 786

  Fly   757 LVLLNDRSQGGASLEDGALEMLIHRRHLFNDGGGVGEALNETQYGKGLIARGKLYLILDSATDGD 821
            :.:|.||:|||:||:||:||:::|||.|.:|..|||||||||:||.|||||||.:|....:||.:
  Fly   787 MAILTDRAQGGSSLKDGSLELMVHRRLLKDDAFGVGEALNETEYGDGLIARGKHHLFFGKSTDRE 851

  Fly   822 TVT----ERKTEKELFLPFWKFFS----------KTGGVEITPSKSLPDFNDLPQSVHLLTLEFF 872
            .|:    ||.|:.|..||.|||||          :|....|....||.    ||:.|||||||.:
  Fly   852 GVSLKGIERLTQLEKLLPTWKFFSNMEDYSADEWQTAFTNIFSGISLV----LPKPVHLLTLEPW 912

  Fly   873 SEQEILIRFEHFL----DKSEGRVISFNIRDIFDSLGGLAIRETTLDGNMPLSDMKRFKF----- 928
            .|.::|:||||.:    |.|..:.:.||::::..:.....|||||||||..|.:.:|.:|     
  Fly   913 HENQLLVRFEHIMENGEDASYSQPVQFNVKNVLSAFDVEGIRETTLDGNAWLDESRRLQFAPDPE 977

  Fly   929 ------------------------------HAQES------GTKPSSV--EYSTAQHK------- 948
                                          :|.|:      |.:.:.:  |..|.|.|       
  Fly   978 EAAFNTYATFSQPAESVHLLSAEKPMLGVKYADEALPAGQLGAESNRIRRETETRQEKKDEGRSS 1042

  Fly   949 -----PLEAVKSDEASL-FAVTLYPMQIRTFII 975
                 |..:.|||.::. :.:.|.||:|||||:
  Fly  1043 KSTEGPYNSFKSDSSNQEYIIELSPMEIRTFIV 1075

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 169/275 (61%)
Alpha-mann_mid 359..434 CDD:214875 47/75 (63%)
Glyco_hydro_38C 483..973 CDD:285047 222/578 (38%)
LManIINP_609408.1 GH38N_AMII_LAM_like 47..323 CDD:212121 169/276 (61%)
Alpha-mann_mid 370..445 CDD:214875 47/75 (63%)
Glyco_hydro_38C 502..957 CDD:285047 197/464 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64053912
eggNOG 1 0.900 E1_KOG1959
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 649 1.000 Inparanoid score I165
Isobase 1 0.950 0 Normalized mean entropy S4230
OrthoDB 1 1.010 D201312at2759
OrthoFinder 1 1.000 FOG0001898
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11607
RoundUp 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.