DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and LManI

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_001260350.1 Gene:LManI FlyBaseID:FBgn0032253 Length:950 Species:Drosophila melanogaster

Alignment Length:956 Identity:596/957 (62%)
Similarity:733/957 (77%) Gaps:28/957 (3%)


  Fly    37 MVNIHLVPHSHNDVGWLKTVDQSYYGYKNKIHHAGVQYILDSVVSQLLQDPKRRFIQVETAFFAK 101
            |:|:|||||||:||||||||||.|||.:|||.|||||||||:||.:||:|..||||||||.||||
  Fly     1 MINVHLVPHSHDDVGWLKTVDQYYYGSQNKIQHAGVQYILDTVVEELLKDSSRRFIQVETFFFAK 65

  Fly   102 WWNVQSESMKKVVTKLVNEGRFEFTGGAWSMNDEANVNYQGVIDQFTVGLKFLNETFGSCGRPRV 166
            |::.|:|::::.|.|||.:||.||.||||||||||.|:||.|:|||.:||::|.:|||.||||.|
  Fly    66 WYSEQTETVQRAVKKLVAQGRLEFAGGAWSMNDEATVHYQSVVDQFNLGLRYLKDTFGDCGRPTV 130

  Fly   167 GWQIDTFGHSREQAAIFAHMGYDGQFFSRMDHNDKDTRMNDLTMEMIWDASESMSGVSLFSGMLY 231
            |||||.||||||.|:|||.|.::|:||:|||:.||..||.||.|||||.:|||:...::|:||||
  Fly   131 GWQIDPFGHSREMASIFAQMAFNGEFFARMDYVDKKQRMLDLEMEMIWQSSESLKNSNIFTGMLY 195

  Fly   232 NFYSDTPGFCFDILCTDQPIIDGDSEENNVKQRVDDFISYAKNVSEVYITNHIMVPMGGDFQYED 296
            |.||..|||||||.|.|.|||||:|.:|||..||.:||.|.||:|:.|.:.|||||||.||||||
  Fly   196 NHYSAPPGFCFDINCEDAPIIDGESYDNNVDARVSEFIDYVKNMSKSYRSTHIMVPMGDDFQYED 260

  Fly   297 AKVNYKNMDKLIKYINERQASGSKYNIFYSTPSCYLNSLHQSLESWPNKTQDFFPYAHEKNSFWT 361
            |.||:|||||||||:|:||::||:.|:|||||||||..|||..::|||||:|||||:.:.:|:||
  Fly   261 AAVNFKNMDKLIKYVNDRQSTGSQVNVFYSTPSCYLYELHQLKQTWPNKTEDFFPYSSDSHSYWT 325

  Fly   362 GFFTSRPTQKRFERDGNHMLQVAKQLSVLANLTSEEHKIDLDYLRQVMGVMQHHDAITGTEKQAV 426
            |:||||||||||.|||||..|..|||||||||:..::..|||.|.|.||:||||||:||||||||
  Fly   326 GYFTSRPTQKRFHRDGNHFFQTVKQLSVLANLSGTQYSEDLDNLSQAMGIMQHHDAVTGTEKQAV 390

  Fly   427 SDDYDRMMYEAIVGASNNARDALRLLTNMPYGEFESCLRLNISECAFTKDGADNVLVTLYNPLAH 491
            :.||||::::|||||.|:||||||.|||:..|||||||.||||.||||:|.|:||:|||.|||||
  Fly   391 ASDYDRLLFKAIVGAENSARDALRSLTNLTSGEFESCLELNISVCAFTQDTANNVIVTLVNPLAH 455

  Fly   492 SSTQYVRIPVKEENYQVTDEKGRTVPSEVVPVPWQVLALEYRSNDTQHELVFKATVNKVSSYSI- 555
            |||||||:|.|.|||.|||||||.|.||||||||||||||:|.|||||||||:|:|:|::::.| 
  Fly   456 SSTQYVRVPAKNENYIVTDEKGREVFSEVVPVPWQVLALEHRPNDTQHELVFEASVDKIANFLIR 520

  Fly   556 -----KKVESSEVKHSSIKKINPREDNNSETVVENSVVKLVMDNHTGRLKSVEMNGVSEKIVQNF 615
                 |.:...:|:.       |.|.:..|..||.|:|||..|..||.||:|:|||.:|.|.|.|
  Fly   521 VLPSPKNIAEDQVQF-------PVERSQDELTVETSLVKLTFDTTTGGLKTVKMNGFTENIQQTF 578

  Fly   616 GVYKSH----------TSCAYTFRQDGDIELFENDFEFTVYEGSLVKEVHQHVNDWISQVIRIYE 670
            |:||.:          :|.||.||..||||:..|..|.:.|.|:.|||||||||:||||||||||
  Fly   579 GIYKGYRGNNGESKNRSSGAYVFRPYGDIEIVNNKVELSFYNGTKVKEVHQHVNEWISQVIRIYE 643

  Fly   671 GVSRVELEWMVGPIPIDDKLGSEFVTNFKSEISSNGVFYTDSNGRELMKRVKDKREDFVSDLSRQ 735
            .|:|||.||:|||||.||.:|.|.:|.|.|.|||.|.|||||||||:::|.:::||.|..|:| :
  Fly   644 DVNRVEFEWLVGPIPTDDDVGKEIITRFSSNISSKGKFYTDSNGREILERERNQREHFTPDMS-E 707

  Fly   736 PVSGNFYPVTSRIALQDDTKRLVLLNDRSQGGASLEDGALEMLIHRRHLFNDGGGVGEALNETQY 800
            .:|||:||||.:|:||||.||:.|||||:|||.||:||.||:::|||.|.:|..|||||||||||
  Fly   708 AISGNYYPVTGQISLQDDEKRITLLNDRAQGGTSLKDGELELMLHRRLLNDDAFGVGEALNETQY 772

  Fly   801 GKGLIARGKLYLILDSATDGDTVTERKTEKELFLPFWKFFSKTGGVEITPSKSLPDFNDLPQSVH 865
            |.|||||||:||||| |.||.. .:|..:.:|...|||||||:.||.......:|||..:|:||.
  Fly   773 GTGLIARGKIYLILD-AVDGKP-NQRLLQHQLDQHFWKFFSKSNGVASVNRNMIPDFFGIPESVE 835

  Fly   866 LLTLEFFSEQEILIRFEHFLDKSEGRVISFNIRDIFDSLGGLAIRETTLDGNMPLSDMKRFKFHA 930
            ||:||.:|:.:||||.|:|  .:||.|:||||..:|:||.|..|.||||||||.|.|:|||||..
  Fly   836 LLSLEPYSKDQILIRLENF--NTEGNVVSFNIYPLFESLDGYQIWETTLDGNMLLEDVKRFKFAQ 898

  Fly   931 QESGTKPSSVEYSTAQHKPLEAVKSDEASLFAVTLYPMQIRTFIIK 976
            ..:|:.||||||..|.|.||.|..:..||.|.|||.|||||||||:
  Fly   899 DGTGSIPSSVEYYHAPHNPLTANSTMNASGFVVTLVPMQIRTFIIQ 944

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 185/273 (68%)
Alpha-mann_mid 359..434 CDD:214875 53/75 (71%)
Glyco_hydro_38C 483..973 CDD:285047 291/506 (58%)
LManINP_001260350.1 GH38N_AMII_LAM_like 2..276 CDD:212121 185/274 (68%)
Alpha-mann_mid 323..398 CDD:286360 53/75 (71%)
Glyco_hydro_38C 536..941 CDD:285047 233/410 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64053740
eggNOG 1 0.900 E1_KOG1959
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 649 1.000 Inparanoid score I165
Isobase 1 0.950 0 Normalized mean entropy S4230
OrthoDB 1 1.010 D201312at2759
OrthoFinder 1 1.000 FOG0001898
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11607
RoundUp 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.