DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and LManVI

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_609253.1 Gene:LManVI FlyBaseID:FBgn0032069 Length:1007 Species:Drosophila melanogaster

Alignment Length:1009 Identity:661/1010 (65%)
Similarity:812/1010 (80%) Gaps:33/1010 (3%)


  Fly     1 MTYL-GRILFLSILLVLFAKQSEAVCGYESCPETKANMVNIHLVPHSHNDVGWLKTVDQSYYGYK 64
            |.|| |.:||:: ||.:..:.||..||||:||:||.||:|||:|||||:||||||||||.:||::
  Fly     1 MKYLCGIVLFVA-LLAISVRPSEEACGYEACPKTKTNMINIHMVPHSHDDVGWLKTVDQYFYGHR 64

  Fly    65 NKIHHAGVQYILDSVVSQLLQDPKRRFIQVETAFFAKWWNVQSESMKKVVTKLVNEGRFEFTGGA 129
            :.|.|||||||:|:|:::|::||.||||||||:||||||..|||:.|:||.|||||||.||||||
  Fly    65 SNIQHAGVQYIIDTVIAELIKDPARRFIQVETSFFAKWWAEQSETAKQVVRKLVNEGRLEFTGGA 129

  Fly   130 WSMNDEANVNYQGVIDQFTVGLKFLNETFGSCGRPRVGWQIDTFGHSREQAAIFAHMGYDGQFFS 194
            |||||||.||||.||||||:|||||::|||||.|||:|||||.||||||||:|||.|||||:||:
  Fly   130 WSMNDEAAVNYQSVIDQFTLGLKFLDDTFGSCARPRIGWQIDPFGHSREQASIFAQMGYDGEFFA 194

  Fly   195 RMDHNDKDTRMNDLTMEMIWDASESMSGVSLFSGMLYNFYSDTPGFCFDILCTDQPIIDGDSEEN 259
            ||||.||:.|:::|.||||||||:|:|...:|:|:||..||..||:|||:.|.|.||||..|.:|
  Fly   195 RMDHRDKNDRIDNLGMEMIWDASDSLSNDEIFTGLLYRHYSAPPGYCFDVHCGDDPIIDTKSYDN 259

  Fly   260 NVKQRVDDFISYAKNVSEVYITNHIMVPMGGDFQYEDAKVNYKNMDKLIKYINERQASGSKYNIF 324
            |||.|||||:||..:|::.|.:||||:|||.|||||||:||:|||||||||:|||||.||.:|:|
  Fly   260 NVKSRVDDFLSYVTSVAQHYRSNHIMIPMGDDFQYEDAQVNFKNMDKLIKYVNERQAEGSTFNLF 324

  Fly   325 YSTPSCYLNSLHQSLESWPNKTQDFFPYAHEKNSFWTGFFTSRPTQKRFERDGNHMLQVAKQLSV 389
            ||||:|||||||:.|::|||||||||||..:.||:|||:||||||||||||||||:|||||||||
  Fly   325 YSTPACYLNSLHEGLQTWPNKTQDFFPYGSDDNSYWTGYFTSRPTQKRFERDGNHILQVAKQLSV 389

  Fly   390 LANLTSEEHKIDLDYLRQVMGVMQHHDAITGTEKQAVSDDYDRMMYEAIVGASNNARDALRLLTN 454
            .|.|.:::.|.||:|||::||||||||||||||||.|||||||::|:||:|..|.|||.||.|||
  Fly   390 FAELNTKQQKEDLEYLREIMGVMQHHDAITGTEKQHVSDDYDRILYDAILGGVNTARDGLRKLTN 454

  Fly   455 MPYGEFESCLRLNISECAFTKDGADNVLVTLYNPLAHSSTQYVRIPVKEENYQVTDEKGRTVPSE 519
            :|.|||||||:|||||||||||.||||:|||||||||:||||||:|||.|||:|||||||.|.||
  Fly   455 LPNGEFESCLQLNISECAFTKDDADNVVVTLYNPLAHTSTQYVRVPVKNENYEVTDEKGRVVASE 519

  Fly   520 VVPVPWQVLALEYRSNDTQHELVFKATVNKVSSYSIKKVESSEVKH------------------- 565
            ||||.|||||||:|:|||||||||||:|:|:::|.||||.|.|.|:                   
  Fly   520 VVPVAWQVLALEFRNNDTQHELVFKASVDKIANYYIKKVASQETKNVAAHTKSKRSIKAEEANLE 584

  Fly   566 --SSIKKINPR-------EDNNSETVVENSVVKLVMDNHTGRLKSVEMNGVSEKIVQNFGVYKSH 621
              ...||::..       :|:..||||:.|.||||:||.||.||:||||||||.|.|::|||:::
  Fly   585 VPKRFKKVHSLKNATETFDDDEGETVVQTSQVKLVIDNKTGLLKTVEMNGVSENIDQSYGVYRTY 649

  Fly   622 TSCAYTFRQ--DGDIELFENDFEFTVYEGSLVKEVHQHVNDWISQVIRIYEGVSRVELEWMVGPI 684
            .|.||.|||  ..|..:.....|||||:|:|||||||..:::||||||||||.:.||:||.||||
  Fly   650 DSGAYVFRQYHQADFIVQYEGVEFTVYDGALVKEVHQQFSEYISQVIRIYEGKNLVEIEWQVGPI 714

  Fly   685 PIDDKLGSEFVTNFKSEISSNGVFYTDSNGRELMKRVKDKREDFVSDLSRQPVSGNFYPVTSRIA 749
            ..:::.|.|.|..|.|.|:|:||.||||||||::|||||:||.|...|.|||.:.|:||||||||
  Fly   715 EREEEFGREVVIIFNSTIASDGVSYTDSNGREMIKRVKDQRETFTPGLDRQPTAANYYPVTSRIA 779

  Fly   750 LQDDTKRLVLLNDRSQGGASLEDGALEMLIHRRHLFNDGGGVGEALNETQYGKGLIARGKLYLIL 814
            |||..||:.:||||:|||||:.:|.||:::|||.:.:||.||||||||.:||:.:|||||:||||
  Fly   780 LQDSKKRIAVLNDRAQGGASMLNGQLELMLHRRLVRDDGYGVGEALNEEKYGQPMIARGKVYLIL 844

  Fly   815 DSATDGDTVTERKTEKELFLPFWKFFSKTGGVEITPSKSLPDFNDLPQSVHLLTLEFFSEQEILI 879
             |.:|..|..||:.|||:.|||||||||..|.....:||:|.|||.|:||||||||.|::.|:|:
  Fly   845 -SPSDESTAAEREAEKEIHLPFWKFFSKNTGSTTAAAKSVPSFNDFPKSVHLLTLEPFNDDEVLL 908

  Fly   880 RFEHFLDKSEGRVISFNIRDIFDSLGGLAIRETTLDGNMPLSDMKRFKFHAQESGTKPSSVEYST 944
            |.|:|||.:||:|:|||||.|||.|.|:.|||||||||:|||||||||||...||.||.:|||.|
  Fly   909 RVENFLDHTEGQVVSFNIRPIFDYLNGVEIRETTLDGNLPLSDMKRFKFHHDSSGQKPDAVEYFT 973

  Fly   945 AQHKPLEAVKSDEASLFAVTLYPMQIRTFIIKTE 978
            :.||||.|.:|.|||.|:|||:||||||||||||
  Fly   974 SAHKPLAAEQSQEASEFSVTLHPMQIRTFIIKTE 1007

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 193/273 (71%)
Alpha-mann_mid 359..434 CDD:214875 59/75 (79%)
Glyco_hydro_38C 483..973 CDD:285047 313/520 (60%)
LManVINP_609253.1 GH38N_AMII_LAM_like 38..312 CDD:212121 193/274 (70%)
Alpha-mann_mid 359..434 CDD:286360 59/75 (79%)
Glyco_hydro_38C 482..1002 CDD:285047 313/521 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64053607
eggNOG 1 0.900 E1_KOG1959
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 649 1.000 Inparanoid score I165
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D201312at2759
OrthoFinder 1 1.000 FOG0001898
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11607
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.