DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and LManV

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_001285763.1 Gene:LManV FlyBaseID:FBgn0032068 Length:982 Species:Drosophila melanogaster

Alignment Length:984 Identity:669/985 (68%)
Similarity:817/985 (83%) Gaps:8/985 (1%)


  Fly     1 MTYLGRILFLSILLVLFAKQSEAVCGYESCPETKANMVNIHLVPHSHNDVGWLKTVDQSYYGYKN 65
            |.:||.:|.:: .|.|.||.::||||||||.|||:||:|||||||||:||||||||||.|||::|
  Fly     1 MKFLGIVLCVA-FLALQAKSAQAVCGYESCHETKSNMINIHLVPHSHDDVGWLKTVDQYYYGHRN 64

  Fly    66 KIHHAGVQYILDSVVSQLLQDPKRRFIQVETAFFAKWWNVQSESMKKVVTKLVNEGRFEFTGGAW 130
            .|.|||||||:|:|:|:|:::|.||||||||:||:||||.|||:|:.||..||||||.:|..|||
  Fly    65 NIQHAGVQYIIDTVISELIKNPDRRFIQVETSFFSKWWNEQSETMRAVVKMLVNEGRLQFINGAW 129

  Fly   131 SMNDEANVNYQGVIDQFTVGLKFLNETFGSCGRPRVGWQIDTFGHSREQAAIFAHMGYDGQFFSR 195
            ||||||.||||.||||||||||||::|||.|||||||||||.||||||||:|:|.||:||:||||
  Fly   130 SMNDEAAVNYQSVIDQFTVGLKFLDDTFGVCGRPRVGWQIDPFGHSREQASIYAQMGFDGEFFSR 194

  Fly   196 MDHNDKDTRMNDLTMEMIWDASESMSGVSLFSGMLYNFYSDTPGFCFDILCTDQPIIDGDSEENN 260
            ||||||..|||||.:|||||||||:|.|.||:|:||.||.||||||||:.|:|.||||.||.:||
  Fly   195 MDHNDKGRRMNDLALEMIWDASESLSQVKLFTGLLYTFYWDTPGFCFDVHCSDDPIIDSDSYDNN 259

  Fly   261 VKQRVDDFISYAKNVSEVYITNHIMVPMGGDFQYEDAKVNYKNMDKLIKYINERQASGSKYNIFY 325
            ||.||||||:||..|:|.:.|||||:|||||||||||:||||||||||||:||||:|||||||.|
  Fly   260 VKSRVDDFIAYAAQVAEKFRTNHIMIPMGGDFQYEDAEVNYKNMDKLIKYVNERQSSGSKYNIIY 324

  Fly   326 STPSCYLNSLHQSLESWPNKTQDFFPYAHEKNSFWTGFFTSRPTQKRFERDGNHMLQVAKQLSVL 390
            |||:|||||:|:|::|:||||.|||||..:.||||||::|||||||||||||||:||||||||..
  Fly   325 STPTCYLNSVHKSVQSYPNKTLDFFPYGSDTNSFWTGYYTSRPTQKRFERDGNHILQVAKQLSAF 389

  Fly   391 ANLTSEEHKIDLDYLRQVMGVMQHHDAITGTEKQAVSDDYDRMMYEAIVGASNNARDALRLLTNM 455
            |.|:|.:.|.||:|||::||||||||||||||||.|||||||::|:||||....|.||||.|||:
  Fly   390 AELSSTQQKEDLEYLREIMGVMQHHDAITGTEKQHVSDDYDRILYDAIVGGVKTAGDALRKLTNL 454

  Fly   456 PYGEFESCLRLNISECAFTKDGADNVLVTLYNPLAHSSTQYVRIPVKEENYQVTDEKGRTVPSEV 520
            |.|||||||:||||||||||||||||:|||||.|||::.||||:|||.|||||||||||.|.||:
  Fly   455 PNGEFESCLQLNISECAFTKDGADNVVVTLYNALAHTTKQYVRVPVKNENYQVTDEKGRVVASEI 519

  Fly   521 VPVPWQVLALEYRSNDTQHELVFKATVNKVSSYSIKKVESSE----VKHSSIKKINPREDNNSET 581
            ||||.:|||||:|.:||||||||||:|:|:::|.||||:|.|    |:..|..|.|....::.||
  Fly   520 VPVPAEVLALEFRDSDTQHELVFKASVDKIANYYIKKVDSKESSNGVRVISQPKANAETYDDEET 584

  Fly   582 VVENSVVKLVMDNHTGRLKSVEMNGVSEKIVQNFGVYKSHTSCAYTFRQ--DGDIELFENDFEFT 644
            :|:.|::|||:||.||.||.||||||||.|.|::|:|:::.|.||.|||  .||..:.|:..|||
  Fly   585 IVQTSLIKLVLDNKTGLLKRVEMNGVSENIEQSYGLYRTYDSGAYVFRQYNQGDFVIQEDGVEFT 649

  Fly   645 VYEGSLVKEVHQHVNDWISQVIRIYEGVSRVELEWMVGPIPIDDKLGSEFVTNFKSEISSNGVFY 709
            ||:|:|||||||..:::|||||||.|....||.||:|||||::::.|:|.||.|.|||:||||||
  Fly   650 VYDGALVKEVHQRFSEYISQVIRISEDKPYVEFEWLVGPIPVEEEFGTEVVTIFSSEIASNGVFY 714

  Fly   710 TDSNGRELMKRVKDKREDFVSDLSRQPVSGNFYPVTSRIALQDDTKRLVLLNDRSQGGASLEDGA 774
            ||||||||::|.|||||||..:|:.||.|||:||:||||||||..|||.:||||:|||.|::||.
  Fly   715 TDSNGRELIRREKDKREDFTPELAVQPTSGNYYPITSRIALQDSNKRLAILNDRAQGGTSMKDGQ 779

  Fly   775 LEMLIHRRHLFNDGGGVGEALNETQYGKGLIARGKLYLILDSATDGDTVTERKTEKELFLPFWKF 839
            :|:::|||.:.:||.||||||||.:||:.||||||::|||::| |..|..||:.|||..||.|||
  Fly   780 IELMLHRRLVRDDGYGVGEALNEEKYGQPLIARGKVFLILNAA-DESTSAEREAEKEFHLPLWKF 843

  Fly   840 FSKTGGVEITPSKSLPDFNDLPQSVHLLTLEFFSEQEILIRFEHFLDKSEGRVISFNIRDIFDSL 904
            |||..|.....:||:|.|:|.|:||||||||.|::.|||:|.|:|.|..||:|:|||||.|||.|
  Fly   844 FSKNTGSTTAAAKSVPSFDDFPKSVHLLTLEPFNDDEILLRVENFKDHIEGKVVSFNIRPIFDYL 908

  Fly   905 GGLAIRETTLDGNMPLSDMKRFKFHAQESGTKPSSVEYSTAQHKPLEAVKSDEASLFAVTLYPMQ 969
            .|:.|||||||||:||||||:|||||:.||.:.|..||.|:.||||.|.::.:|:.|||||||||
  Fly   909 NGVEIRETTLDGNLPLSDMKQFKFHAEGSGIRGSEPEYYTSSHKPLSANQTQDAAEFAVTLYPMQ 973

  Fly   970 IRTFIIKTE 978
            |||||||.|
  Fly   974 IRTFIIKHE 982

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 207/273 (76%)
Alpha-mann_mid 359..434 CDD:214875 59/75 (79%)
Glyco_hydro_38C 483..973 CDD:285047 306/496 (62%)
LManVNP_001285763.1 GH38N_AMII_LAM_like 37..311 CDD:212121 207/274 (76%)
Alpha-mann_mid 358..433 CDD:286360 59/75 (79%)
Glyco_hydro_38C 481..977 CDD:285047 306/497 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64053568
eggNOG 1 0.900 E1_KOG1959
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 649 1.000 Inparanoid score I165
Isobase 1 0.950 0 Normalized mean entropy S4230
OrthoDB 1 1.010 D201312at2759
OrthoFinder 1 1.000 FOG0001898
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11607
RoundUp 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.