DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and LManIII

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_001285762.1 Gene:LManIII FlyBaseID:FBgn0032066 Length:1003 Species:Drosophila melanogaster

Alignment Length:998 Identity:693/999 (69%)
Similarity:823/999 (82%) Gaps:30/999 (3%)


  Fly    10 LSILLVLFAK---QSEAVCGYESCPETKANMVNIHLVPHSHNDVGWLKTVDQSYYGYKNKIHHAG 71
            |:|||.|||.   |||||| ||||||||:||:|||||||||:|:||||||||.|||.|:.|.|||
  Fly     7 LAILLALFASYIVQSEAVC-YESCPETKSNMINIHLVPHSHDDLGWLKTVDQYYYGNKHNIQHAG 70

  Fly    72 VQYILDSVVSQLLQDPKRRFIQVETAFFAKWWNVQSESMKKVVTKLVNEGRFEFTGGAWSMNDEA 136
            ||||.|:||::|.:|.:||||||||.||||||..|||:.||:|..||||||.|||||||||||||
  Fly    71 VQYIFDTVVAELSKDSRRRFIQVETGFFAKWWEDQSETKKKLVKTLVNEGRLEFTGGAWSMNDEA 135

  Fly   137 NVNYQGVIDQFTVGLKFLNETFGSCGRPRVGWQIDTFGHSREQAAIFAHMGYDGQFFSRMDHNDK 201
            .||||.|||||.|||||||:.||.|||||||||||.||||||||::||.|.:|||||:|||.|||
  Fly   136 AVNYQSVIDQFAVGLKFLNDNFGVCGRPRVGWQIDAFGHSREQASMFAQMAFDGQFFARMDQNDK 200

  Fly   202 DTRMNDLTMEMIWDASESMSGVSLFSGMLYNFYSDTPGFCFDILCTDQPIIDGDSEENNVKQRVD 266
            :.|:::|.:||:|||||::..:..|:|||||.||..||||||.||.|.|||||.|.:||||.|||
  Fly   201 NKRVDNLGLEMVWDASETLEEMDFFTGMLYNHYSAPPGFCFDSLCQDDPIIDGKSYDNNVKSRVD 265

  Fly   267 DFISYAKNVSEVYITNHIMVPMGGDFQYEDAKVNYKNMDKLIKYINERQASGSKYNIFYSTPSCY 331
            ||::||.|::..|.:||||||||.|||||:|.:|||||||||||:||||||||||||||||..||
  Fly   266 DFLNYASNLAGYYRSNHIMVPMGDDFQYENAYMNYKNMDKLIKYVNERQASGSKYNIFYSTAGCY 330

  Fly   332 LNSLHQSLESWPNKTQDFFPYAHEKNSFWTGFFTSRPTQKRFERDGNHMLQVAKQLSVLANLTSE 396
            |||||:||:|:|||||||.|::||..||||||||||||||||||||||:|||||||||||:|:.|
  Fly   331 LNSLHKSLQSFPNKTQDFLPHSHEAKSFWTGFFTSRPTQKRFERDGNHILQVAKQLSVLADLSGE 395

  Fly   397 EHKIDLDYLRQVMGVMQHHDAITGTEKQAVSDDYDRMMYEAIVGASNNARDALRLLTNMPYGEFE 461
            |...|||||||:|.||||||||||||||.||:||||::|:||:|.:|.||||||:|||.|.|||:
  Fly   396 EQHKDLDYLRQIMAVMQHHDAITGTEKQEVSNDYDRLLYDAILGGANTARDALRVLTNQPNGEFQ 460

  Fly   462 SCLRLNISECAFTKDGADNVLVTLYNPLAHSSTQYVRIPVKEENYQVTDEKGRTVPSEVVPVPWQ 526
            |||:||||||||||:.||:.:|||||||||:||||||:||||::||||||||..|.||:|||||:
  Fly   461 SCLKLNISECAFTKENADDFMVTLYNPLAHTSTQYVRVPVKEDSYQVTDEKGGLVASELVPVPWE 525

  Fly   527 VLALEYRSNDTQHELVFKATVNKVSSYSIKKVESS-----EVKHSSIKKINPREDN--------- 577
            ||:||:|:|||||||||||:|||:::|.|||::.:     .|...:.:.:|..|.|         
  Fly   526 VLSLEFRNNDTQHELVFKASVNKIATYFIKKIDKTTEVDITVNTQTEQSVNEEESNVKVPKRFKK 590

  Fly   578 ------------NSETVVENSVVKLVMDNHTGRLKSVEMNGVSEKIVQNFGVYKSHTSCAYTFRQ 630
                        :.||:|:||::|||:||:|||||:||||||||.|.|.||:||:..||.|.|||
  Fly   591 VHSLKTDLETLDDQETIVQNSLIKLVIDNNTGRLKTVEMNGVSEDIDQTFGMYKTARSCHYIFRQ 655

  Fly   631 DGDIELFENDFEFTVYEGSLVKEVHQHVNDWISQVIRIYEGVSRVELEWMVGPIPIDDKLGSEFV 695
            |.|:||.|:.|:||||:|..|||||||||:||||||||||||:|||.||:|||:||||:||.|.|
  Fly   656 DADLELVEDAFDFTVYDGESVKEVHQHVNEWISQVIRIYEGVNRVEFEWLVGPVPIDDELGKEIV 720

  Fly   696 TNFKSEISSNGVFYTDSNGRELMKRVKDKREDFVSDLSRQPVSGNFYPVTSRIALQDDTKRLVLL 760
            |.|||.|||.|||||||||||:|:|.|||||||..|||.||||||:||||||:||||.:||:|||
  Fly   721 TIFKSGISSGGVFYTDSNGREMMRREKDKREDFSPDLSEQPVSGNYYPVTSRMALQDSSKRMVLL 785

  Fly   761 NDRSQGGASLEDGALEMLIHRRHLFNDGGGVGEALNETQYGKGLIARGKLYLILDSATDGDTVTE 825
            |||||||||||||.|||::||||:|.||.|..||:||.|:||||||||||:|.|::..||.|.:|
  Fly   786 NDRSQGGASLEDGRLEMMLHRRHIFADGSGAAEAINEQQFGKGLIARGKLFLYLNAIEDGATASE 850

  Fly   826 RKTEKELFLPFWKFFSKTGGVEITPSKSLPDFNDLPQSVHLLTLEFFSEQEILIRFEHFLDKSEG 890
            |..|||:.|||||||||:..::...:|:|.|||||||||||||||.:|:.|||:|.|:|||::||
  Fly   851 RVAEKEIHLPFWKFFSKSNNIQSDVTKTLSDFNDLPQSVHLLTLEPYSKDEILLRLENFLDQTEG 915

  Fly   891 RVISFNIRDIFDSLGGLAIRETTLDGNMPLSDMKRFKFHAQESGTKPSSVEYSTAQHKPLEAVKS 955
            .|:||:||.|||.||||.|||||||||:|||||||.|||...||...|..||.|:.||||.|.|:
  Fly   916 NVVSFSIRQIFDDLGGLEIRETTLDGNLPLSDMKRLKFHHDGSGPSHSVPEYFTSLHKPLAADKT 980

  Fly   956 DEASLFAVTLYPMQIRTFIIKTE 978
            .:||.|:|||.||||||||||.|
  Fly   981 QDASEFSVTLKPMQIRTFIIKKE 1003

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 195/273 (71%)
Alpha-mann_mid 359..434 CDD:214875 63/75 (84%)
Glyco_hydro_38C 483..973 CDD:285047 337/516 (65%)
LManIIINP_001285762.1 GH38N_AMII_LAM_like 37..311 CDD:212121 195/274 (71%)
Alpha-mann_mid 358..433 CDD:286360 63/75 (84%)
Glyco_hydro_38C 603..998 CDD:285047 275/395 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64053521
eggNOG 1 0.900 E1_KOG1959
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 649 1.000 Inparanoid score I165
Isobase 1 0.950 0 Normalized mean entropy S4230
OrthoDB 1 1.010 D201312at2759
OrthoFinder 1 1.000 FOG0001898
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11607
RoundUp 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.