DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and Man2a2

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:XP_008757749.1 Gene:Man2a2 RGDID:1310238 Length:1175 Species:Rattus norvegicus

Alignment Length:1094 Identity:276/1095 (25%)
Similarity:450/1095 (41%) Gaps:235/1095 (21%)


  Fly    35 ANMVNIHLVPHSHNDVGWLKTVDQSYYGYKNKIHHAGVQYILDSVVSQLLQDPKRRFIQVETAFF 99
            |..:.:.:|||||||.||:||.|: ||..:       .|:||:|:||:|.:||:|||:..|.:||
  Rat   163 AEDLQVFVVPHSHNDPGWIKTFDK-YYTEQ-------TQHILNSMVSKLQEDPRRRFLWAEVSFF 219

  Fly   100 AKWWNVQSESMKKVVTKLVNEGRFEFTGGAWSMNDEANVNYQGVIDQFTVGLKFLNETFGSCGRP 164
            ||||:..|...:..|.:||..|:.|...|.|.|.||||.:|..::||...|.::|....|:  .|
  Rat   220 AKWWDNISAQKRAAVRRLVGNGQLEIATGGWVMPDEANSHYFALVDQLIEGHQWLERNLGA--TP 282

  Fly   165 RVGWQIDTFGHSREQAAIFAHMGYDGQFFSRMDHNDKDTRMNDLTMEMIWDAS-ESMSGVSLFSG 228
            |.||.:|.||||.....:............|:.:..|.......::|.:|..: :|.|...:|..
  Rat   283 RSGWAVDPFGHSSTMPYLLRRANLTSMLIQRVHYAIKKHFAATHSLEFMWRQTWDSDSSTDIFCH 347

  Fly   229 MLYNFYS-DTPGFCF---DILCT-DQPIIDGDS------------EENNVKQRVDDFISYAKNVS 276
            |: .||| |.|..|.   .|.|. |...:.|..            .|.||..|....:...:..|
  Rat   348 MM-PFYSYDVPHTCGPDPKICCQFDFKRLPGGRINCPWKVPPRAITEANVADRAALLLDQYRKKS 411

  Fly   277 EVYITNHIMVPMGGDFQYE-----DAKVNYKNMDKLIKYINER-----QASGSKYNIFYSTPSCY 331
            .::.::.::||:|.||:|:     ||:  :.|..:|..::|.:     ||.       :.|.|.|
  Rat   412 RLFRSSVLLVPLGDDFRYDKPQEWDAQ--FFNYQRLFDFLNSKPEFHVQAQ-------FGTLSEY 467

  Fly   332 LNSLHQSL--------ESWPNKTQDFFPYAHEKNSFWTGFFTSRPTQKRFERDGNHMLQVAKQLS 388
            .::|::..        ..:|..:.|||.||..::.:|||::||||..|..:|.....|:.|:.|.
  Rat   468 FDALYKRTGVEPGARPPGFPVLSGDFFSYADREDHYWTGYYTSRPFYKSLDRVLETHLRGAEVLY 532

  Fly   389 VLA-------NLTSEEHKID---LDYLRQVMGVMQHHDAITGTEKQAVSDDYDRMMYEAIVGASN 443
            .||       .||.:....|   |...|:.:|:.|||||||||.|:||..||...:..::|....
  Rat   533 SLALAHARRSGLTGQYPLSDYAVLTEARRTLGLFQHHDAITGTAKEAVVVDYGVRLLRSLVSLKQ 597

  Fly   444 ---NARDALRLLTNMPYGEFESCLRLNISECAFTKDG----------ADNVLVTLYNPLAHSSTQ 495
               ||...|.|.....|........|.:.:...:.|.          :....|.::|||......
  Rat   598 VIINAAHYLVLGDKETYSFDPRAPFLQMDDSRVSHDALPERTVIRLDSSPRFVVVFNPLEQERLS 662

  Fly   496 YVRIPVKEENYQVTDEKGRTVPSEV------------------VPVPWQVLAL-----------E 531
            .|.:.|.....:|..|:|:.:..::                  |||....|.|           .
  Rat   663 VVSLLVNSPRVRVLSEEGQPLSVQISVQWSSATNMVPDVYQVSVPVRLPALGLGVLQLQPDLDGP 727

  Fly   532 YRSNDTQHELV--FKATVNKVSSYSIKKVESSEVKHSSIKKINPREDNNSETVVENSVVKLVMDN 594
            |....:.|..:  .|.:|::.:::.::.|:|                ..|:..:.|..:::....
  Rat   728 YTLQSSVHVYLNGVKLSVSRQTTFPLRVVDS----------------GTSDFAISNRYMQVWFSG 776

  Fly   595 HTGRLKSVEMNGVSEKIVQNFG----VYKSHT----SCAYTFRQDGDIELF--ENDFEFTVYEGS 649
            .||.||||..  |.|:..|...    ||.:.|    |.||.|..|.:.:.:  :......|.||.
  Rat   777 LTGLLKSVRR--VDEEQEQQVDMKLFVYGTRTSKDKSGAYLFLPDNEAKPYVPKKPPVLRVTEGP 839

  Fly   650 LVKEV---HQHVNDWISQVIRIYE--GVSRVELEWMVGPIPIDDKLGSEFVTNFKSEISSNGVFY 709
            ...||   ::|.:    ||||:|.  ||..:.|: :...:.|.|.:..|......::|.|.|.|:
  Rat   840 FFSEVAAYYEHFH----QVIRLYNLPGVEGLSLD-VSFQVDIRDYVNKELALRIHTDIDSQGTFF 899

  Fly   710 TDSNGRELMKRVKDKREDFVSDLSRQPVSGNFYPVTSRIALQDDTKRLVLLNDRSQGGASLEDGA 774
            ||.||.::..|         ..|.:.|:..||||:.....:||..:||.|...::.|.:||.:|.
  Rat   900 TDLNGFQVQPR---------KYLKKLPLQANFYPMPVMAYIQDSQRRLTLHTAQALGVSSLGNGQ 955

  Fly   775 LEMLIHRRHLFNDGGGVGEALNETQYGKGLIARGKLYLILDSAT--------------------- 818
            ||:::.||.:.:|..|:|:.|.:.:     |......|:|:..|                     
  Rat   956 LEVILDRRLMQDDNRGLGQGLKDNK-----ITCNHFRLLLERRTLMSPEPGFFSKLAAMFRGLIF 1015

  Fly   819 DGDTVTERKTEKELFLPFWKFFSKTGGVEI-TP------------SKSLPDF----NDLPQSVHL 866
            ..:|:...|.::|....:....|....:.: ||            |.:|..|    :.||...||
  Rat  1016 SSNTIRNSKVQQERSTSYPSLLSHMTSMYLNTPPLVLPVAKRESTSPTLHSFHPLASPLPCDFHL 1080

  Fly   867 LTLEFFSEQE--------ILIRFEHFLDKSEGRVISFNIRDIFDSLGGLAIRETTLDGNMPLSDM 923
            |.|.....::        :::..:.|....|.:.:.||.              ||..|.:.|..:
  Rat  1081 LNLRMLPAEDTLPAADAALILHRKGFDCGLEAKNLGFNC--------------TTSQGKLALGSL 1131

  Fly   924 KRFKFHAQE-SGTKPSSVEYSTAQHKPLEAVKSDEASLFAVTLYPMQIRTFIIK 976
                ||..: ...:|:|:........|..:..        ::|.||:|.||.::
  Rat  1132 ----FHGLDVLFLQPTSLTLLYPLASPSNSTD--------ISLEPMEISTFRLR 1173

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 94/296 (32%)
Alpha-mann_mid 359..434 CDD:214875 34/85 (40%)
Glyco_hydro_38C 483..973 CDD:285047 125/583 (21%)
Man2a2XP_008757749.1 PLN02701 140..1174 CDD:178304 276/1095 (25%)
CE4_SF 165..508 CDD:301698 110/363 (30%)
Alpha-mann_mid 503..588 CDD:214875 34/85 (40%)
Glyco_hydro_38C 761..1170 CDD:285047 105/456 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.