DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and Man2a1

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_037111.2 Gene:Man2a1 RGDID:3038 Length:1148 Species:Rattus norvegicus

Alignment Length:1068 Identity:273/1069 (26%)
Similarity:454/1069 (42%) Gaps:194/1069 (18%)


  Fly    27 YESCPETKANMVNIHLVPHSHNDVGWLKTVDQSYYGYKNKIHHAGVQYILDSVVSQLLQDPKRRF 91
            ||: .|.....:.:.:|||||||.|||||.: .|:..|       .|||.:::|.:|.:|..|:|
  Rat   155 YEA-DEWDREPLQVFVVPHSHNDPGWLKTFN-DYFRDK-------TQYIFNNMVLKLKEDSSRKF 210

  Fly    92 IQVETAFFAKWWNVQSESMKKVVTKLVNEGRFEFTGGAWSMNDEANVNYQGVIDQFTVGLKFLNE 156
            |..|.::.||||::.....|:.|..|:..|:.|...|.|.|.|||..:|..:|||...|.::|.:
  Rat   211 IWSEISYLAKWWDIIDNPKKEAVKSLLQNGQLEIVTGGWVMADEATTHYFALIDQLIEGHQWLEK 275

  Fly   157 TFGSCGRPRVGWQIDTFGHSREQAAIFAHMGYDGQFFSRMDHNDKDTRMNDLTMEMIWDASESMS 221
            ..|.  :||.||.||.||||.....:....|:......|:.::.|.......|:|..|..:..:.
  Rat   276 NLGV--KPRSGWAIDPFGHSPTMTYLLKRAGFSHMLIQRVHYSVKKHFSLQKTLEFFWRQNWDLG 338

  Fly   222 GVSLFSGMLYNFYS-DTPGFC---------FDIL--------C----TDQPIIDGDSEENNVKQR 264
            ..:.....:..||| |.|..|         ||..        |    ..:.|..|     ||:.|
  Rat   339 STTDILCHMMPFYSYDIPHTCGPDPKICCQFDFKRLPGGRYGCPWGVPPEAISPG-----NVQSR 398

  Fly   265 VDDFISYAKNVSEVYITNHIMVPMGGDF---QYEDAKVNYKNMDKLIKYINERQASGSKYNIFYS 326
            ....:...:..|:::.|..::.|:|.||   :|.:..:.|:|.::|..|:|.:  ...|..|.:.
  Rat   399 AQMLLDQYRKKSKLFRTKVLLAPLGDDFRFSEYTEWDLQYRNYEQLFSYMNSQ--PHLKVKIQFG 461

  Fly   327 TPSCYLNSLHQSLES--------WPNKTQDFFPYAHEKNSFWTGFFTSRPTQKRFERDGNHMLQV 383
            |.|.|.::|.:|:.:        :|..:.|||.||...:.:|:|:|||||..||.:|.....|:.
  Rat   462 TLSDYFDALEKSVAAEKKGGQSVFPALSGDFFTYADRDDHYWSGYFTSRPFYKRMDRIMESRLRT 526

  Fly   384 AKQLSVLANLTSEEHKID----------LDYLRQVMGVMQHHDAITGTEKQAVSDDYDRMMYEAI 438
            |:.|..||...::::||:          |...|:.:|:.|||||||||.|..|..||...:::::
  Rat   527 AEILYHLALKQAQKYKINKFLSSPHYTTLTEARRNLGLFQHHDAITGTAKDWVVVDYGTRLFQSL 591

  Fly   439 VGASNNARDALRLLTNMPYGEFES-----CLRLNISECAFTKDGADNVL---------VTLYNPL 489
            ........|:..||.......::|     .|.::..:.:.......|::         :.:|||.
  Rat   592 NSLEKIIGDSAFLLILKDKKLYQSDPSKAFLEMDTKQSSQDSLPKKNIIQLSAQEPRYLVVYNPF 656

  Fly   490 AHSSTQYVRIPVKEENYQVTDEKGRTVPSEVVPVPWQVLALEYRSNDTQHELVFKATVNKVSSYS 554
            .......|.:.|.....:|..:.|:.|..:|..| |:.:.   .::...:|:.|.|.:..:....
  Rat   657 EQERHSVVSVRVNSATVKVLSDLGKAVEVQVSAV-WKDMR---TTSQAAYEVAFLAHLPPLGLKV 717

  Fly   555 IKKVES-SEVKH--------------SSIKKINPREDNNSETVVENSVVKLVMDNHTGRLKSV-- 602
            .|.:|| |...|              |.|..:....|:.....:|||.:.|..| .:|.::.|  
  Rat   718 YKILESQSSSSHLADYFLYNNDGQAESGIFHMKNMVDSGDAITIENSFLTLGFD-RSGLMEKVRR 781

  Fly   603 -EMNGVSEKIVQNFGVY----KSHTSCAYTFRQDGDIELF---ENDFEFTVYEGSLVKEVH---Q 656
             |.|...|..|| |..|    |...|.||.|..||..:.:   ...| ..|..|.:..:|.   :
  Rat   782 KEDNKQQELKVQ-FLWYGTTNKRDKSGAYLFLPDGQGQPYVSLRTPF-VRVTRGRIYSDVTCFLE 844

  Fly   657 HVNDWISQVIRIY--EGVSRVELEWMVGPIPIDDKLGSEFVTNFKSEISSNGVFYTDSNGRELMK 719
            ||    :..:|:|  :|:....:| :...:.|......|.|....|:|::...:|||.||.::..
  Rat   845 HV----THKVRLYHIQGIEGQSME-VSNIVDIRSVHNREIVMRISSKINNQNRYYTDLNGYQIQP 904

  Fly   720 RVKDKREDFVSDLSRQPVSGNFYPVTSRIALQDDTKRLVLLNDRSQGGASLEDGALEMLIHRRHL 784
            |         ..:::.|:..|.||:::...:||...||.||:.:|.|.:|:..|.:|:.:.||.:
  Rat   905 R---------RTMAKLPLQANVYPMSTMAYIQDAAHRLTLLSAQSLGASSMASGQIEVFMDRRLM 960

  Fly   785 FNDGGGVGEALNETQYGKGLIARGKLYLILDSATDGDTVTERKTE----------------KELF 833
            .:|..|:|:.:::.:      ....|:.||....:|..:.|.|..                ...|
  Rat   961 QDDNRGLGQGVHDNK------ITANLFRILLEKRNGMNMEEDKKSPVSYPSLLSHMTSAFLNHPF 1019

  Fly   834 LPFWKFFSKTGGVEITPSKSLPDF----NDLPQSVHLLTL--------EFFSEQEILIRFEHFLD 886
            ||    ...:|.:.....:.|.:|    :.||..:||:.|        :.:|::..||..     
  Rat  1020 LP----MVLSGQLPSPAIELLSEFRLLQSSLPCDIHLVNLRTIQSKVGKGYSDEAALILH----- 1075

  Fly   887 KSEGRVISFNIRDIFD---SLGGLAIRETTLDGNMPLSDMKRFKFHAQESGTKPSSVEYSTAQHK 948
                       |.:||   |...:.:..:|..|.|.:.  |.|...|.||.. |||:   :..|.
  Rat  1076 -----------RKVFDCQLSSRAMGLPCSTTQGKMSIP--KLFNNFAVESFI-PSSL---SLMHS 1123

  Fly   949 PLEAVKSDEASLFAVTLYPMQIRTFIIK 976
            |.:|..:.|     |:|.||:|.|..|:
  Rat  1124 PPDAQNTSE-----VSLSPMEISTSRIR 1146

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 87/298 (29%)
Alpha-mann_mid 359..434 CDD:214875 33/85 (39%)
Glyco_hydro_38C 483..973 CDD:285047 129/551 (23%)
Man2a1NP_037111.2 PLN02701 127..1148 CDD:178304 273/1069 (26%)
GH38N_Man2A1 164..507 CDD:212131 103/360 (29%)
Alpha-mann_mid 502..587 CDD:214875 33/85 (39%)
Glyco_hydro_38C 733..1142 CDD:285047 109/463 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.