DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and ams1

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_593979.1 Gene:ams1 PomBaseID:SPAC513.05 Length:1077 Species:Schizosaccharomyces pombe

Alignment Length:943 Identity:181/944 (19%)
Similarity:324/944 (34%) Gaps:296/944 (31%)


  Fly    21 SEAVCGYESCPETKANMVNIHLVPHSHNDVGWL-------KTVDQSYYGYKNKIHHAGVQYILDS 78
            ||||.      |...:..|:..:.|.|.|..||       :.:.:|:....|         |:| 
pombe   270 SEAVF------EKNNDKANVFAIGHCHIDTAWLWPFAETRRKIVRSWATQMN---------IMD- 318

  Fly    79 VVSQLLQDPKRRFIQVETAFFAKWWNVQSESMKKVVTKLVNEGRFEFTGGAWSMNDEANVNYQGV 143
                  :.|:.:|: ...|....|.......:.:.:.:.||:.:|...||:|..:|....|.:.:
pombe   319 ------RYPEYQFV-CSQALQYLWLKEDHPDVFEKLKEYVNQNKFIPIGGSWVEHDTNIPNGESL 376

  Fly   144 IDQFTVGLKFLNETFGSCGRPRVGWQIDTFGHSREQAAIFAHMGYDGQFFSRMDHNDKDTRMNDL 208
            |.||.:|..|..:.||.  |.|..|..||||:|.:...|....|.| :|               |
pombe   377 IRQFLLGQHFFEKEFGV--RCRTFWLPDTFGYSSQIPQICRLCGMD-RF---------------L 423

  Fly   209 TMEMIWDASESMSGVSLFSGMLYNFYSDTPGFCFD---ILCTDQP--IIDGDSEENNVKQRVDDF 268
            |.::.|      :.::.|....:|:.:      .|   ::|...|  ....|:..|:|...:|..
pombe   424 TQKLSW------NNINSFPTSTFNWVA------LDGSQVICHMPPANTYTADTNVNDVLHSIDQH 476

  Fly   269 ISYAKNVSEVYITNHIMVPMGGDFQYEDAKVNYKNMDKLIKYINERQASGSKYNIFYSTPSCYL- 332
            .:...:.:.:.:..   :..||.....:.      ::||      |:..|....:.| .|:..| 
pombe   477 KNLVNDQAGLLVFG---IGDGGGGPTPEM------LEKL------RRCKGIANTVGY-LPNVKLG 525

  Fly   333 -------------NSLHQSLESWPNKTQDFFPYAHEKNSFWTGFFTSRPTQKRFERDGNHMLQVA 384
                         .:..|:|.||..:.  :|       .|..|.:|::...|:..|.....|..|
pombe   526 NTVDEFFDGILKRTNAGQTLPSWNGEL--YF-------EFHRGTYTTQAELKKLMRKVEIALHDA 581

  Fly   385 KQLSVLANLTSEEHKIDLDYLRQVMG---VMQHHDAITGTEKQAVSDD-----------YDRMMY 435
            :.:|.||::.|:::....:.|:.:..   :.|.||.:.|:..:.|..|           .:.:::
pombe   582 EYVSTLASIFSKDYSYPKESLQDLWRDTLLCQFHDVLPGSCIEMVYKDAIPIMSKVLKNTEALLW 646

  Fly   436 EAI------VGASNNARDALRLLTNMPYG--------------EFESCLRLNISECAFTKDGADN 480
            :||      ..:|::.::.|.||..:|:.              .||||            || ..
pombe   647 QAIEQLGFKKASSSDNKEQLCLLNTLPWNVRGVITETEENKLVYFESC------------DG-KG 698

  Fly   481 VLVTLYNPLAHSSTQYVRIPVKEENY---------------------------QVTDEK------ 512
            :|...:..|.|.:..|    .|::|:                           ::.|.|      
pombe   699 ILTAAHTSLKHPAAAY----QKDDNFILVNDHLRVTIAPNGLILSLFDLHKEREILDLKSGKNHA 759

  Fly   513 --GRTVPSEVVPVPWQVLALEYRSNDTQHELVFKATVNKVSSYSIKKVESSEVKHSSIKKINPRE 575
              .:.|..|..|:.||..       ||:             .:|::|.|..:....|||:..|. 
pombe   760 GANQYVLFEDTPLSWQAW-------DTE-------------VFSLEKYEVLDKGKVSIKESGPL- 803

  Fly   576 DNNSETVVENSVVKLVMDNHTGRLKSVE-MNGVSEKIVQNFGVYKS-HTSCAYTFRQDGDIELFE 638
              .:..||:..:.:|   :|.....|:| .|..||....||..... |.||.: .:.:..:::..
pombe   804 --RASVVVDIPISEL---SHMKATISLEGYNDCSEFTGVNFTCEVDWHESCKF-LKVEFPVDIHS 862

  Fly   639 NDFEFTVYE---GSLVKEVHQHVNDWISQVIRIYEGVSRVEL---------EWMVGPIPIDD-KL 690
               ||..||   |...:..|.:.: |         .|::.|:         ::..|...::| |.
pombe   863 ---EFASYETQFGITKRPTHYNTS-W---------DVAKFEVCHQKFADYSDFTYGVSVLNDCKY 914

  Fly   691 GSEFVTNFKSEISSNGVFYTDSNGRELMKRVKDKREDFVSDLSRQPVSGNFYPVTSRIALQDDTK 755
            |                |.|..|...|......|:.|..:|:.:..:....||.:.  .|...|.
pombe   915 G----------------FSTHGNLMRLSLLRSPKQPDAHADMGKHTIRYAVYPHSK--PLDSSTV 961

  Fly   756 RLV-------LLNDRSQGGASLEDGALEMLIHRRHLFNDGGGVGEA------LNETQYGKGLIAR 807
            |..       .|..|:...|:|:            :|:....|||.      :...:.||.:|.|
pombe   962 RAAHKFNSNFRLLTRASDTANLD------------IFDAFQLVGEPNVILSHIKMAEKGKSIILR 1014

  Fly   808 --------GKLYLILDSATDGDTVTERKTEKEL 832
                    .:..|::.|.|..........|::|
pombe  1015 VYESLGGKSRARLVIKSLTVASVTKCNGLEEDL 1047

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 57/285 (20%)
Alpha-mann_mid 359..434 CDD:214875 18/89 (20%)
Glyco_hydro_38C 483..973 CDD:285047 77/422 (18%)
ams1NP_593979.1 AMS1 44..1077 CDD:223460 181/944 (19%)
GH38N_AMII_ScAms1_like 282..538 CDD:212123 62/319 (19%)
Alpha-mann_mid 555..634 CDD:286360 18/79 (23%)
Glyco_hydro_38C 664..1073 CDD:285047 88/472 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.