DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and MAN2B2

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_056089.1 Gene:MAN2B2 HGNCID:29623 Length:1009 Species:Homo sapiens

Alignment Length:1086 Identity:272/1087 (25%)
Similarity:470/1087 (43%) Gaps:196/1087 (18%)


  Fly     4 LGRILFLSILLVLFAKQSEAVCGYESCPETKANMVNIHLVPHSHNDVGWLKTVDQSYYGYKNKIH 68
            :|::.:|.:|..|...:...|        ..|..:...:|||||.||||:.||.:|...|...::
Human     1 MGQLCWLPLLAPLLLLRPPGV--------QSAGPIRAFVVPHSHMDVGWVYTVQESMRAYAANVY 57

  Fly    69 HAGVQYILDSVVSQLLQDPKRRFIQVETAFFAKWWN-VQSESMKKVVTKLVNEGRFEFTGGAWSM 132
                    .|||.:|.:..:||||.||..||..||: |.|:..|..|.:|:.|||.||..|...|
Human    58 --------TSVVEELARGQQRRFIAVEQEFFRLWWDGVASDQQKYQVRQLLEEGRLEFVIGGQVM 114

  Fly   133 NDEANVNYQGVIDQFTVGLKFLNETFGSCGRPRVGWQIDTFGHSREQAAIFAHMGYDGQFFSRMD 197
            :|||..:....|.|.|.|..||.||||.  ||:..|.:|.||.|.....:||..|::....||:|
Human   115 HDEAVTHLDDQILQLTEGHGFLYETFGI--RPQFSWHVDPFGASATTPTLFALAGFNAHLGSRID 177

  Fly   198 HNDKDTRMNDLTMEMIWDASESMS-GVSLFSGML--YNF-------YSDTPGFCFD-ILCTDQPI 251
            ::.|........::.:|..|.|:| ...:|:.::  |::       :|:..||.:: :....:|.
Human   178 YDLKAAMQEARGLQFVWRGSPSLSERQEIFTHIMDQYSYCTPSHIPFSNRSGFYWNGVAVFPKPP 242

  Fly   252 IDG----DSE---ENNVKQRVDDFISYAKNVSEVYITNHIMVPMGGDFQYEDAKVNYKNMDKLIK 309
            .||    .||   ..|:....:..::..|..:..:.|.|::.|.|.|.|:.:|.|.:.|||.|:.
Human   243 QDGVYPNMSEPVTPANINLYAEALVANVKQRAAWFRTPHVLWPWGCDKQFFNASVQFANMDPLLD 307

  Fly   310 YINERQASGSKYNIFYSTPSCYLNSLHQSLESWPNKT-QDFFPYAHEKNSFWTGFFTSRPTQKRF 373
            :||. .|:....::.|:|...|..:||....:|..:. .||.||:.|....||||:|||.:.|..
Human   308 HINS-HAAELGVSVQYATLGDYFRALHALNVTWRVRDHHDFLPYSTEPFQAWTGFYTSRSSLKGL 371

  Fly   374 ERDGNHMLQVAKQLSVLANLTSEEHKID-------LDYLRQVMGVMQHHDAITGTEKQAVSDDYD 431
            .|..:.:|...:.:.......:....:|       |..||..:..:||||||||||...|.|.|.
Human   372 ARRASALLYAGESMFTRYLWPAPRGHLDPTWALQQLQQLRWAVSEVQHHDAITGTESPKVRDMYA 436

  Fly   432 RMMYEAIVGASNNARDALRLLTNMPYGEFESCLRLNISECAFTKDGADNVLVTLYNPLAHSSTQY 496
            ..:...::|..       :|:.::...|.:....:..|..|    |......::|||||.:.|..
Human   437 THLASGMLGMR-------KLMASIVLDELQPQAPMAASSDA----GPAGHFASVYNPLAWTVTTI 490

  Fly   497 VRIPVKEENYQVTDEKGRTVPSEVVPVPWQVLALEYRSNDTQ----HELVFKATVNKVS--SYSI 555
            |.:.|.....:||||.|..|||::             .|.|:    ::|:...|:..:|  .|:|
Human   491 VTLTVGFPGVRVTDEAGHPVPSQI-------------QNSTETPSAYDLLILTTIPGLSYRHYNI 542

  Fly   556 KKV----ESSEVKHSSI-------KKINPREDNNSETV--VENSVVKLVMDNHTGRLKSV--EMN 605
            :..    |.::...:::       :::..|..:....:  |.|....:::|..|..:.|:  ..:
Human   543 RPTAGAQEGTQEPAATVASTLQFGRRLRRRTSHAGRYLVPVANDCYIVLLDQDTNLMHSIWERQS 607

  Fly   606 GVSEKIVQNFGVYKSHTSCAYTFRQDGDIEL--FENDFEFT---------------VYEGSLVKE 653
            ..:.::.|.|..|  |.        :||::.  ..:::.||               :..|.||.|
Human   608 NRTVRVTQEFLEY--HV--------NGDVKQGPISDNYLFTPGKAAVPAWEAVEMEIVAGQLVTE 662

  Fly   654 VHQH-------------VNDWISQVIRIYEG---VSRVELEWMVGPIPIDDKLGSEFVTNFKSEI 702
            :.|:             :...::.|.:.::|   ..|:|.|:..||:    :|..|.|....:.:
Human   663 IRQYFYRNMTAQNYTYAIRSRLTHVPQGHDGELLCHRIEQEYQAGPL----ELNREAVLRTSTNL 723

  Fly   703 SSNGVFYTDSNGRELMKRVKDKREDFVSDLSRQPVSGNFYPVTSRIALQDDTKRLVLLNDRSQGG 767
            :|..|.|:|:||.::.:|      .:||.::.. ::.|:||:.....::|...|||||::|:.|.
Human   724 NSQQVIYSDNNGYQMQRR------PYVSYVNNS-IARNYYPMVQSAFMEDGKSRLVLLSERAHGI 781

  Fly   768 ASLEDGALEMLIHRRHLFNDGG---GVGEALNETQYGKGLIARGKLYLILDSATDGDTVTERKTE 829
            :|..:|.:|:::||| |:|:..   |....||:|.     :....|:|:|.|.:....:.:|...
Human   782 SSQGNGQVEVMLHRR-LWNNFDWDLGYNLTLNDTS-----VVHPVLWLLLGSWSLTTALRQRSAL 840

  Fly   830 KELFLPFWKFFSKTGGVEITPSKSLPDFNDLPQSVHLLTLEF----FSE---------------- 874
            .....|...|....|.....|.....:...||.::||..|..    :|.                
Human   841 ALQHRPVVLFGDLAGTAPKLPGPQQQEAVTLPPNLHLQILSIPGWRYSSNHTEHSQNLRKGHRGE 905

  Fly   875 -----QEILIRFEHFLDKSEGRVIS----FNIRDIFDSLGG-LAIRETTLDGNMPLSDMKRFKFH 929
                 :.:|:|..|..:..|..|:|    .|:..:..:||. :|:.|.:|.|...||.:.|:.:.
Human   906 AQADLRRVLLRLYHLYEVGEDPVLSQPVTVNLEAVLQALGSVVAVEERSLTGTWDLSMLHRWSWR 970

  Fly   930 AQESGTKPSSVEYSTAQHKPLEAVKSDEASLFAVTLYPMQIRTFII 975
            ......:..:...|.....|:            :|::|.:||||.|
Human   971 TGPGRHRGDTTSPSRPPGGPI------------ITVHPKEIRTFFI 1004

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 95/292 (33%)
Alpha-mann_mid 359..434 CDD:214875 27/82 (33%)
Glyco_hydro_38C 483..973 CDD:285047 123/577 (21%)
MAN2B2NP_056089.1 GH38N_AMII_Epman_like 27..352 CDD:212122 107/336 (32%)
Alpha-mann_mid 358..439 CDD:214875 27/81 (33%)
Glyco_hydro_38C 581..1002 CDD:285047 98/460 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D201312at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11607
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.