DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and aman-1

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_508811.1 Gene:aman-1 WormBaseID:WBGene00018877 Length:955 Species:Caenorhabditis elegans

Alignment Length:980 Identity:330/981 (34%)
Similarity:524/981 (53%) Gaps:86/981 (9%)


  Fly     6 RILFLSI-LLVLFAKQSEAVCGYESC--PETKANMVNIHLVPHSHNDVGWLKTVDQSYYGYKNKI 67
            :::||.: |||:::.|.   |.:.:|  .:...|::..||:||:|:|:||:|||||.::|.|.::
 Worm     4 QVIFLFLGLLVIYSSQD---CAWNTCHKVDQDPNVITAHLIPHTHDDLGWIKTVDQYFWGAKPEL 65

  Fly    68 HHAGVQYILDSVVSQLLQDPKRRFIQVETAFFAKWWNVQSESMKKVVTKLVNEGRFEFTGGAWSM 132
            ...|||||.::|:.:||::|.|||...||.|..:|:...|:..:..:.|||..|:.|..||.|..
 Worm    66 VPVGVQYIYNTVIDELLKNPDRRFSFAETGFLWRWYTSNSDFDRHQLQKLVKNGQIEIIGGGWVQ 130

  Fly   133 NDEANVNYQGVIDQFTVGLKFLNETFGSCGRPRVGWQIDTFGHSREQAAIFAHMGYDGQFFSRMD 197
            ||||..:|..:|||.|:||:.|.:.||.||:|..|||||.||||||.|.|:..|||...:|:|:.
 Worm   131 NDEATSHYVDIIDQMTLGLQRLEQIFGECGKPVTGWQIDPFGHSREMANIYREMGYSSVYFARIH 195

  Fly   198 HNDKDTRMNDLTMEMIWDASESMSGVSLFSGMLYN-FYSDTPGFCFDILCTDQPIIDG-DSEENN 260
            :.:|..|:.:.|:|.:|:.|:.::...||:|..:| .|....|||:|.||.|.||:|. :.|..|
 Worm   196 YLEKQIRLKNKTLEFMWNTSDDITDNKLFTGAFFNDNYGPPEGFCWDSLCGDDPIMDNLNIEGYN 260

  Fly   261 VKQRVDDFISYAKNVSEVYITNHIMVPMGGDFQYEDAKVNYKNMDKLIKYINERQASGSKYNIFY 325
            ||::||.|:.:.||.:....||.:|:.||.||||.:|...|.|:||||||:|  ..:..|..:.|
 Worm   261 VKEKVDAFVDHVKNQAAHQSTNQVMLLMGSDFQYTNANSWYVNLDKLIKYVN--ADTSKKVRVIY 323

  Fly   326 STPSCYLNSLHQSLESWPNKTQDFFPYAHEKNSFWTGFFTSRPTQKRFERDGNHMLQVAKQLSVL 390
            |||:||..::.....:...|..||||||..::|:|||:|||||..|...|..:.|||:||||.|:
 Worm   324 STPACYTKAVQAKTPTLSVKHDDFFPYASGRHSYWTGYFTSRPAFKGMIRQASCMLQLAKQLDVI 388

  Fly   391 ANLTSEEHKIDLDYLRQVMGVMQHHDAITGTEKQAVSDDYDRMMYEAIVGASNNARDALRLLTNM 455
            |||..|:.. |::.||:...::|||||:|||.|:.|:.||::.:.:.:........|.::.:.  
 Worm   389 ANLGPEDDS-DIEILREASALVQHHDAVTGTAKENVTRDYEKQLAKGVSEVEVVINDFMKKMN-- 450

  Fly   456 PYG---EFESCLRLNISECAFTKDGADNVLVTLYNPLAHSSTQYVRIPVKEENYQVTDEKGRTVP 517
            |.|   :...|..:|.:.|. ..:|:....|.::|.........:|||..::...:.|.....:.
 Worm   451 PDGLDPKLVLCPLINETICK-PINGSSEFSVVIFNSNGRYFNGTIRIPYSQKTAVLRDAHKNVLE 514

  Fly   518 SEVVPVPWQVLALEYRSNDTQ------HELVFKATVNKVSSYSIKKVESSEVKHSSIKKINPRED 576
            |::|.. :|:..|:    ||.      |..|....:...:.:..|..:...|..::.||.|...:
 Worm   515 SQIVET-FQIDQLK----DTDRLPYEIHVFVRVPPLGYTTVFVEKGSKPERVHFNNRKKFNTNVE 574

  Fly   577 NNSETVV----ENSVVKLVMDNHTGRLKSVEM-----NGVSEKIVQNFGVY----KSHTSCAYTF 628
            ..:|.::    ....:..:.:..|.:.:|:..     .|:..|..|..|.|    |:....|.| 
 Worm   575 IQNEYLIAGFDSQGYLSYITEKATKKKRSIRQEFFYYEGIDSKDDQPSGAYIFRPKTQQPIALT- 638

  Fly   629 RQDGDIELFENDFEFTVYEGSLVKEVHQHVNDWISQVIRIYEGVSRVELEWMVGPIPIDDK--LG 691
                      :.....|..|:::.||.|.|:.::||.||:..|.:.:|.||:|||||.:.|  :.
 Worm   639 ----------SKLALEVVPGAIINEVRQKVSPFVSQQIRLPRGKNYIEFEWIVGPIPKETKNPIT 693

  Fly   692 SEFVTNFKSEISSNGVFYTDSNGRELMKRVKDKREDF-VSDLSRQPVSGNFYPVTSRIALQDDTK 755
            .||||.:.:|:.|....:||||||:.|:|..|....| .||  .:|::||:||:||...::|:..
 Worm   694 KEFVTRYTTEVHSKNQSFTDSNGRQAMERFFDGATSFEYSD--TEPIAGNYYPITSFGYIKDENA 756

  Fly   756 RLVLLNDRSQGGASLEDGALEMLIHRRHLFNDGGGVGEALNET-QYGKGLIARGKLYLILDSATD 819
            :..::.||:||..: .||.:|:::|||..::|..||.|||:|. :.|.||:|.|| :::|.:...
 Worm   757 QFSVITDRAQGMVA-SDGVVEIMLHRRCFYDDHFGVEEALDEPGKDGAGLVAMGK-HIVLFTDVK 819

  Fly   820 GDTVTERKTEKELFLPFWKFFSKTGGVEITPSKSLPDFN----------DLPQSVHLLTLEFFSE 874
            ..|...|....:.|......|:|      .|.|.  :||          :||..:||||||.:.:
 Worm   820 ASTSQLRPLAIDNFHQPVLAFNK------NPEKF--EFNRLLEYSGLKFELPIGIHLLTLEKWHK 876

  Fly   875 QEILIRFEHFLDKSEGRVI-SFNIRDIFDSLGGLAIRETTLDGNMPLSDMKRFKFHAQESGTKPS 938
            :..|||||:.....||..| .|:...||.:...::.:|..|..|..:...|       |||:...
 Worm   877 KSSLIRFENIYHGEEGNSIKEFDPTHIFTNFDIVSFKELLLGANRVVGKNK-------ESGSSFR 934

  Fly   939 SVEYS 943
            |.|.|
 Worm   935 SFEKS 939

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 123/275 (45%)
Alpha-mann_mid 359..434 CDD:214875 37/75 (49%)
Glyco_hydro_38C 483..973 CDD:285047 138/496 (28%)
aman-1NP_508811.1 GH38N_AMII_LAM_like 36..313 CDD:212121 124/279 (44%)
Alpha-mann_mid 357..431 CDD:286360 37/75 (49%)
Glyco_hydro_38C 537..944 CDD:285047 126/434 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64054172
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 643 1.000 Inparanoid score I433
Isobase 1 0.950 0 Normalized mean entropy S4230
OMA 1 1.010
OrthoDB 1 1.010 D201312at2759
OrthoFinder 1 1.000 FOG0001898
OrthoInspector 1 1.000 T375228
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11607
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.960

Return to query results.
Submit another query.