DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and aman-2

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_505995.2 Gene:aman-2 WormBaseID:WBGene00010284 Length:1145 Species:Caenorhabditis elegans

Alignment Length:936 Identity:239/937 (26%)
Similarity:411/937 (44%) Gaps:171/937 (18%)


  Fly    38 VNIHLVPHSHNDVGWLKTVDQSYYGYKNKIHHAGVQYILDSVVSQLLQDPKRRFIQVETAFFAKW 102
            :.:.::||||.|.||:.|.:: ||..:.:       .|||.:...|.:..:.|||..|.:||..|
 Worm   181 LEVIVIPHSHCDPGWIMTFEE-YYNRQTR-------NILDGMAKHLAEKDEMRFIYAEISFFETW 237

  Fly   103 WNVQSESMKKVVTKLVNEGRFEFTGGAWSMNDEANVNYQGVIDQFTVGLKFLNETFGSCGRPRVG 167
            |..|::.:||.|...:..|:||...|.|.|.||||.:|..:|.:...|.:::....|....|:..
 Worm   238 WRDQADEIKKKVKGYLEAGKFEIVTGGWVMTDEANAHYHSMITELFEGHEWIQNHLGKSAIPQSH 302

  Fly   168 WQIDTFGHSREQAAIFAHMGYDGQFFSRMDHNDKDTRMNDLTMEMIWDASESMSGVSLFSGMLYN 232
            |.||.||.|.....:............|:.::.|........:|..|......:|.......:..
 Worm   303 WSIDPFGLSPSMPHLLTSANITNAVIQRVHYSVKRELALKKNLEFYWRQLFGSTGHPDLRSHIMP 367

  Fly   233 FYS-DTPGFC---------FDI--------LCTDQPIIDGDSEENNVKQRVDDFISYAKNVSEVY 279
            ||| |.|..|         ||.        .| |..|......::||..|.:......:..|:::
 Worm   368 FYSYDIPHTCGPEPSVCCQFDFRRMPEGGKSC-DWGIPPQKINDDNVAHRAEMIYDQYRKKSQLF 431

  Fly   280 ITNHIMVPMGGDFQYE-DAKVN--YKNMDKLIKYINERQASGSKYNIF--YSTPSCYLNSLHQSL 339
            ..|.|..|:|.||:|: |.:.|  |:|..||.:|:|    |.|::|:.  :.|.|.|...|..::
 Worm   432 KNNVIFQPLGDDFRYDIDFEWNSQYENYKKLFEYMN----SKSEWNVHAQFGTLSDYFKKLDTAI 492

  Fly   340 ----ESWPNKTQDFFPYAHEKNSFWTGFFTSRPTQKRFERDGNHMLQVAKQLSVLANLTSE---E 397
                |..|..:.|||.||...:.:|:|:|||||..|:.:|...|.|:.|:....|||:..|   |
 Worm   493 SASGEQLPTFSGDFFTYADRDDHYWSGYFTSRPFYKQLDRVLQHYLRSAEIAFTLANIEEEGMVE 557

  Fly   398 HKI--DLDYLRQVMGVMQHHDAITGTEKQAVSDDYDRMMYEAIVGASNNARDALRLLTNMPYGEF 460
            .||  .|...|:.:.:.||||.:|||.|..|..||.:.|.:|:....:...:||.:|..:     
 Worm   558 AKIFEKLVTARRALSLFQHHDGVTGTAKDHVVLDYGQKMIDALNACEDILSEALVVLLGI----- 617

  Fly   461 ESCLRLNISECAFTKDGADNVL-----------VTLYNPLAHSSTQYVRI-------------PV 501
            :|..::.:.|....    :|:|           |.|:|.|:.:..:.:.|             |:
 Worm   618 DSTNKMQMDEHRVN----ENLLPEKRVYKIGQNVVLFNTLSRNRNEPICIQVDSLDAGVEADPPI 678

  Fly   502 KEENYQVT-----DEKGRTVPSEVVPVPWQVLALEYRSNDTQHELVFKATVNKVSSYSIK----- 556
            |::  ||:     ||:.:|:   ||             .:...||.|..::..:.|.|.:     
 Worm   679 KKQ--QVSPVIAYDEEKKTL---VV-------------KNGIFELCFMLSLGPMESVSFRLVKNT 725

  Fly   557 ---KVE-----SSEVKHSSIKKINPREDNNSETVVENSVVKLVMDNHTGRLKSVEMNGVSEKIVQ 613
               |||     ::|.|.:|.|.    ...:.:..|:|..|:...|...|.:|.. .:.|.:|.:.
 Worm   726 TTSKVEIITNNAAEFKETSFKS----SSTSGDFTVKNDKVEAEFDGENGMIKRA-TSLVDDKPID 785

  Fly   614 ------NFGVYKS----------HTSCAYTFRQDGDI-ELFENDFEFTVYEGSLVKEVHQHVND- 660
                  ::|..||          :.:.||.|..||:. ||.:...::.:.:|.:|::|....|: 
 Worm   786 LNSHFIHYGARKSKRKFANGNEDNPAGAYLFLPDGEARELKKQSSDWILVKGEVVQKVFATPNND 850

  Fly   661 -WISQVIRIYEGVSRVELEWMVGPIPIDDKLGSEFVTNFKSEISSNGVFYTDSNGRELMKRVKDK 724
             .|.|...:|:|:..::|:   ..:.:..|...|....|.|.::|...|:||.||.:::||   :
 Worm   851 LKILQTYTLYQGLPWIDLD---NEVDVRSKENFELALRFSSSVNSGDEFFTDLNGMQMIKR---R 909

  Fly   725 REDFVSDLSRQPVSGNFYPVTSRIALQDDTKRLVLLNDRSQGGASLEDGALEMLIHRRHLFNDGG 789
            |:      ::.|...||||:::.:.::|||.|:.:.:.::.|.:||..|.:|:::.||...:|..
 Worm   910 RQ------TKLPTQANFYPMSAGVYIEDDTTRMSIHSAQALGVSSLSSGQIEIMLDRRLSSDDNR 968

  Fly   790 GVGEALNETQYGKGLIARGKLYLILDSATDGDTVTER---------KTEKELFLPFWKFFSKTGG 845
            |:.:.:.:   .|..:|..::.:...|::.|:...||         .....|..|..|...    
 Worm   969 GLQQGVRD---NKRTVAHFRIVIEPMSSSSGNKKEERVGFHSHVGHLATWSLHYPLVKMIG---- 1026

  Fly   846 VEITPSKSLPDFN---DLPQSVHLLT 868
             :.|| ||:...|   :|...:||:|
 Worm  1027 -DATP-KSISSKNVEQELNCDLHLVT 1050

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 81/294 (28%)
Alpha-mann_mid 359..434 CDD:214875 32/80 (40%)
Glyco_hydro_38C 483..973 CDD:285047 102/449 (23%)
aman-2NP_505995.2 PLN02701 142..1124 CDD:178304 239/937 (26%)
GH38N_AMII_GMII_SfManIII_like 180..521 CDD:212120 98/353 (28%)
Alpha-mann_mid 516..596 CDD:214875 32/80 (40%)
Glyco_hydro_38C 750..1141 CDD:285047 76/324 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.