DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and aman-3

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_001021474.1 Gene:aman-3 WormBaseID:WBGene00018594 Length:1064 Species:Caenorhabditis elegans

Alignment Length:1000 Identity:246/1000 (25%)
Similarity:428/1000 (43%) Gaps:176/1000 (18%)


  Fly    32 ETKANMVNIHLVPHSHNDVGWLKTVDQSYYGYKNKIHHAGVQYILDSVVSQLLQDPKRRFIQVET 96
            :::...:.::::|.:|.|.|||:|.::         :......|||::...::::.|.||:..|.
 Worm   131 KSRTEKLKVYVLPFTHVDPGWLETFER---------YTKSTNQILDNMHQFMMKNEKMRFMWAEF 186

  Fly    97 AFFAKWWNVQSESMKKVVTKLVNEGRFEFTGGAWSMNDEANVNYQGVIDQFTVGLKFLNETFGSC 161
            .||.:||::|:|.:|:.|.|||.|||.|...|:|.|.||||..:...:|....|.:|:::.||. 
 Worm   187 VFFERWWSLQNEQVKEDVKKLVTEGRLELATGSWVMTDEANPYFPVSVDNIVEGFQFIHKNFGI- 250

  Fly   162 GRPRVGWQIDTFGHSREQAAIFAHMGYDGQFFSRMDHNDKDTRMNDLTMEMIWDASESMSGVS-- 224
             :|:..|..|.||:|.....:|...|......:|:.|..|.|..:...:...|......:|..  
 Worm   251 -KPQTMWSNDPFGYSNSVPYLFKKSGVHRTVINRIHHKLKQTLQSQKAIPFKWRQYFDATGEDDV 314

  Fly   225 LFSGMLYNFY-------SDTPGFC-FDILCTDQPIIDGDSEEN----NVKQRVDDFISYAKNVSE 277
            |...:.|..|       ||....| ||..........|...|.    ||..:.:..::..:.:||
 Worm   315 LTQILPYTHYDILNSCGSDASVCCEFDFKRMTHWSCPGPKPEKITNANVAAKAEKLVNQLEKMSE 379

  Fly   278 VYITNHIMVPMGGDFQY---EDAKVNYKNMDKLIKYINERQASGSKYNIFYSTPSCYLNSLHQSL 339
            :|....|::..|.||::   |:....:.|...:...||:    ||:..|.:.|.:.|.|    .|
 Worm   380 MYKAPVILMMHGDDFRFDMIEEWNQQHDNFIPVFDEINK----GSRVEIRFGTFTDYFN----DL 436

  Fly   340 ESW---------PNKTQDFFPYAHEKNSFWTGFFTSRPTQKR-------FERDGNHMLQVAKQLS 388
            |.|         |..:.|||||......:|||::|:||..||       ..|:|:.||.:.:   
 Worm   437 EKWYSNNKDSEPPTVSGDFFPYMCALGDYWTGYYTTRPFFKRQGRLLHSLIRNGDIMLSMLR--- 498

  Fly   389 VLANLTSEEHKID-----LDYLRQVMGVMQHHDAITGTEKQAVSDDYDRMMYEAIVGAS----NN 444
              .||  ::.||.     |:..|:.:.:.|||||||||.|.:|.|:|..:::.:||..:    |.
 Worm   499 --VNL--KQRKIGENVKRLEAARRNLALFQHHDAITGTSKVSVMDNYSELLHASIVSTNIVLENL 559

  Fly   445 ARDALRLLTNMPYG-EFESCLRLNISECAFTKDGADNVLVTLYNPLAHSSTQYVRIPVKEENYQV 508
            .:..:.|...:..| |.::.:.|..||    |:      :.::|......|...:|.|||....|
 Worm   560 TKSDIDLYPRIHDGIELQTIVDLESSE----KE------IRIFNSHLFEITDVFKIRVKEREVIV 614

  Fly   509 TDEKGRTVPSEVVPVPWQVLALEYRSNDTQHE---LVFKATVNKVSSYSIKKVESSEVKHSSIKK 570
            :.: |:.:.:::.|.        ::.:..:.:   |:|:|||..:|...:|.........:.:.|
 Worm   615 SID-GKIIEAQLEPF--------FQKSKVEKDSFLLLFQATVLPLSMMKVKVQRGDSGGLTKMAK 670

  Fly   571 INPREDN-----NSETV--------VENSVVKLVMDNHTGRLKSVEMNGVSEKI--VQNFGVYKS 620
            |..::.|     :|.|:        :|....|:..|..||.::||.....:.|.  .|:|..||.
 Worm   671 IEAKDTNAWDLGSSWTIASSTSAPNLETPYFKVSNDPITGAIQSVNKLSDNSKFHCQQSFYNYKE 735

  Fly   621 HTSCAYTFRQDGDIELFENDFEFTVYE-----GSLVKEVHQHVNDWISQV-IRIYEGVSRVELEW 679
            ....||..|      |..|..|...|:     |.|.:.::|...:.:.:: |...||.|..|::.
 Worm   736 AGGGAYLMR------LHTNPKEIIEYQWLKVSGPLRQSIYQKSTNVLQRLSIHNVEGPSGEEVDI 794

  Fly   680 MVGPIPIDDKLGSEFVTNFKSEISSNGVFYTDSNGRELMKRVKDKREDFVSDLSRQPVSGNFYPV 744
            .:. |.|..:..:|.:|.|.:: ....:.||||.|.:|::|          |..:.||..|:||:
 Worm   795 SMS-IDITKERNTELMTRFSTK-WDKPLTYTDSVGMQLLRR----------DFYKLPVQSNYYPM 847

  Fly   745 TSRIALQDDTKRLVLLNDRSQGGASLEDGALEMLIHRRHLFNDGGGVGEALNETQYGKGLIARGK 809
            .:...||...:||.::::...|...||.|.:|:.|.|....:||.|:|...:........:.. |
 Worm   848 PTAAVLQSGKQRLSIVSNVEHGARFLESGTVEINIDRILNQDDGKGLGTGPDAIPIDMKPVDM-K 911

  Fly   810 LYLILDSATDGDTVTER----------KTEKELFLPFWKFFSKTGGVEITPSKSLPDFNDL---- 860
            ..||.||.....|...|          ..:..::.|.  .|::       |.|...|..::    
 Worm   912 FKLIFDSLESDPTENSRYSTHSFRAQQAVQTIIYPPM--MFNR-------PPKKEEDIEEIEEIS 967

  Fly   861 ----PQSVHLLTLEFFSE-QEILIRFEHFLDKSEGRV------ISFNIRDIFDSLGGLAIRETTL 914
                |..:.|||:....: :::||.:.|....|..:|      :..::.|:...||...:::|.|
 Worm   968 NLKFPCDIQLLTVRPLEDNKQLLILYRHATVCSSQKVGNCGGELKSSLMDLLIKLGAKQVQKTDL 1032

  Fly   915 DG-----------NMPLSDMKRFKF 928
            .|           .:|..::|.|.|
 Worm  1033 SGVTRVGGIIKVEYLPDYELKTFDF 1057

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 77/290 (27%)
Alpha-mann_mid 359..434 CDD:214875 31/87 (36%)
Glyco_hydro_38C 483..973 CDD:285047 112/506 (22%)
aman-3NP_001021474.1 GH38N_AMII_GMII_SfManIII_like 136..470 CDD:212120 96/353 (27%)
Alpha-mann_mid 465..545 CDD:214875 31/87 (36%)
Glyco_hydro_38C 696..1055 CDD:303346 89/387 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.