DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and Man2b2

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_032576.2 Gene:Man2b2 MGIID:1195262 Length:1018 Species:Mus musculus

Alignment Length:1090 Identity:283/1091 (26%)
Similarity:476/1091 (44%) Gaps:207/1091 (19%)


  Fly    10 LSILLVLFAKQSEAVCGYESCPETKANMVNIHLVPHSHNDVGWLKTVDQSYYGYKNKIHHAGVQY 74
            |..||:|:.:.::           .|..:...:|||||.||||:.||.:|...|...::      
Mouse    10 LGQLLLLWPRAAQ-----------PAGPIRAFVVPHSHMDVGWVFTVQESMRAYAANVY------ 57

  Fly    75 ILDSVVSQLLQDPKRRFIQVETAFFAKWWN-VQSESMKKVVTKLVNEGRFEFTGGAWSMNDEANV 138
              .:||::|::..:||||.||..||..||: |.||..|:.|.:|::|||.||..|...|:|||..
Mouse    58 --TTVVAELVRGGQRRFIAVEQEFFRLWWDGVASEQQKQQVRQLLHEGRLEFVLGGQVMHDEAVT 120

  Fly   139 NYQGVIDQFTVGLKFLNETFGSCGRPRVGWQIDTFGHSREQAAIFAHMGYDGQFFSRMDHNDKDT 203
            :....|.|.|.|..||.||||.  ||:..|.:|.||.|.....:||..|::....||:|::.||.
Mouse   121 HLDDQILQLTEGHGFLYETFGI--RPQFSWHVDPFGASATTPTLFALAGFNAHLISRIDYDLKDA 183

  Fly   204 RMNDLTMEMIWDASESMSG-VSLFSGML--YNF-------YSDTPGFCFD-ILCTDQPIIDG--- 254
            ......::.:|..|.|:|| ..:|:.::  |::       :|:..||.:: :....:|..||   
Mouse   184 MQEAQMLQFVWHGSPSLSGQQEIFTHVMDHYSYCTPSHIPFSNRSGFYWNGVAVFPEPPPDGVYP 248

  Fly   255 -DSEE---NNVKQRVDDFISYAKNVSEVYITNHIMVPMGGDFQYEDAKVNYKNMDKLIKYINERQ 315
             .||.   .|:....:..::..|..:..:.|.|::.|.|.|.|:.:|.|.:.|||.|:.|||:|.
Mouse   249 NMSEPVTGANIHLYAEALVANVKQRAAWFRTPHVLWPWGCDKQFFNASVQFDNMDPLLDYINQRT 313

  Fly   316 ASGSKYNIFYSTPSCYLNSLHQSLESWPNKT-QDFFPYAHEKNSFWTGFFTSRPTQKRFERDGNH 379
            |... .::.|:|.:.|..:||.:..:|..:. |||.||:.|....||||:|||.|.|...|..:.
Mouse   314 AQFG-ISVQYATLNDYFQALHATNMTWGIRDHQDFLPYSSEPLQAWTGFYTSRSTLKGLARQASA 377

  Fly   380 MLQVAKQLSVLANLTSEEHKID-------LDYLRQVMGVMQHHDAITGTEKQAVSDDYDRMMYEA 437
            :|...:.:............:|       |..||..:..:||||||||||...|.:.|...:...
Mouse   378 LLYAGESMFTRYMWPDPSGTLDPTWALQQLQQLRWAVSEVQHHDAITGTESPKVKNMYTEHLRMG 442

  Fly   438 IVGASNNARDALRLLTNMPYG----------------EFESCLRLNISECAFTKDGADNVLVTLY 486
            ::|..       :|:.::..|                :....|.::.....::        .::|
Mouse   443 MLGVR-------KLMVSIALGGPPGSGTGAPKDIMGPQVTPVLSVDTRPVGYS--------ASVY 492

  Fly   487 NPLAHSSTQYVRIPVKEENYQVTDEKGRTVPSEVV-----PVPWQVL------ALEYRSNDTQHE 540
            ||||...|..:.:.|...|..||||.|..|.:::.     |..:.:|      .|.||     |.
Mouse   493 NPLAWKITTIITLTVAFPNVSVTDELGHPVSTQIQNSTKDPSAYDLLILTTIPGLNYR-----HY 552

  Fly   541 LVFKATVNKVSSYSIKKVESSEVKHSSIKKINPREDNNSETVVENSVVKLVMDNHTGRLKSVE-- 603
            .|..|..::..:..:....::.:|.|...:..|.::......|.|....|:.|..|..|.|::  
Mouse   553 QVMHARGDQAGTRELVAPRANTLKFSLKLRNQPSQEGKRLVPVMNDCYILLFDQDTNMLHSIQDR 617

  Fly   604 MNGVSEKIVQNFGVYKSH-------TSCAYTFRQDGDIELFENDFEFTVYEGSLVKEVHQHVNDW 661
            .:..:.::.|.|..|:::       .|..|.|..:...|.........:..|:||.::.|:...:
Mouse   618 QSNRTVRMTQEFLEYQANWDVKQGPISDNYLFAPNNTAEPSWEAVGMEMVAGTLVTDIRQYFYRY 682

  Fly   662 ISQVIRIYE-----------G---VSRVELEWMVGPIPIDDKLGSEFVTNFKSEISSNGVFYTDS 712
            |:....||.           |   ..|:|.::.|||:    .|..|.:....|:::|..|.|:|:
Mouse   683 ITDQEYIYSIHTRLAHPSLAGELLCQRIEQQYRVGPL----DLNREAILRTSSDLNSQQVLYSDN 743

  Fly   713 NGRELMKRVKDKREDFVSDLSRQPVSGNFYPVTSRIALQDDTKRLVLLNDRSQGGASLEDGALEM 777
            ||.::.:|   ..:.|.|:    |:..|:||:.....::||..|||||.:|..|.:|..:|.:|:
Mouse   744 NGYQMQRR---PYKAFKSN----PIPRNYYPMVQSAFIEDDKSRLVLLAERPHGVSSQGNGQVEV 801

  Fly   778 LIHRRHLFNDGG---GVGEALNETQYGKGLIARGKLYLILDSATDGDTVTERKTEKELFLPFWKF 839
            ::||| |:|:..   .....||:|.     |....|:|:|...:   |:|.......:.|     
Mouse   802 MLHRR-LWNNLAWDLKYNLTLNDTS-----IVHPVLWLMLGPKS---TMTALHPRSGVAL----- 852

  Fly   840 FSKTGGVEITPSKSLPDFN------------DLPQSVHLLTLEF----FSE-------------- 874
              :.|.|.:.  |.|.|..            .||.::||..|..    :|.              
Mouse   853 --QHGPVVLL--KELADEETPVHGPHNPWPVTLPPNLHLQILSVPGWTYSRSHAQHLRNLQRGHP 913

  Fly   875 -------QEILIRFEHFLDKSEGRVIS----FNIRDIFDSLGG-LAIRETTLDGNMPLSDMKRFK 927
                   |.:|:|..|..:..|..|:|    .:::.:...||. :|:.|.:|.|...:..::|:.
Mouse   914 EKPQANLQRVLLRLRHLYEAGEDPVLSRPATVDLKVVLRGLGSVVAVEERSLTGTWDVQMLQRWH 978

  Fly   928 FHAQESGTKPSSVE-YSTAQHKPLEAVKSDEASLFAVTLYPMQIRTFIIK 976
            :     .||...:: :.|:..:|      ...|:  :|:||.:||||.||
Mouse   979 W-----STKTDHLKGHPTSPPRP------PGGSI--ITVYPKEIRTFFIK 1015

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 98/292 (34%)
Alpha-mann_mid 359..434 CDD:214875 27/82 (33%)
Glyco_hydro_38C 483..973 CDD:285047 131/570 (23%)
Man2b2NP_032576.2 GH38N_AMII_Epman_like 27..352 CDD:212122 112/336 (33%)
Alpha-mann_mid 358..439 CDD:214875 27/81 (33%)
Glyco_hydro_38C 491..1012 CDD:285047 131/568 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11607
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.