DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and Man2b1

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:XP_006530810.1 Gene:Man2b1 MGIID:107286 Length:1024 Species:Mus musculus

Alignment Length:1027 Identity:410/1028 (40%)
Similarity:589/1028 (57%) Gaps:95/1028 (9%)


  Fly     7 ILFLSILL-VLFAKQSEAVCGYESCPETKANMVNIHLVPHSHNDVGWLKTVDQSYYGYK------ 64
            :|.:|.|. :|.|.......||::||.||..|:|:||:||:|:||||||||||.|||..      
Mouse    31 VLPISFLFWLLLAAPGARAAGYKTCPPTKPGMLNVHLLPHTHDDVGWLKTVDQYYYGMDLDFLNF 95

  Fly    65 -----NKIHHAGVQYILDSVVSQLLQDPKRRFIQVETAFFAKWWNVQSESMKKVVTKLVNEGRFE 124
                 :.:.||.||||||||||.||:.|.||||.||.|||::||..|:.:.:..|..||.:||.|
Mouse    96 MPTVLSDVQHASVQYILDSVVSSLLEKPTRRFIYVEMAFFSRWWKQQTSATQDAVRNLVRQGRLE 160

  Fly   125 FTGGAWSMNDEANVNYQGVIDQFTVGLKFLNETFGSCGRPRVGWQIDTFGHSREQAAIFAHMGYD 189
            |..|.|.|||||..:|..::||.|:||:||.:||||.|.|||.|.||.||||||||::||.||:|
Mouse   161 FVNGGWVMNDEAATHYGAIVDQMTLGLRFLQDTFGSDGLPRVAWHIDPFGHSREQASLFAQMGFD 225

  Fly   190 GQFFSRMDHNDKDTRMNDLTMEMIWDASESMS--GVSLFSGMLYNFYSDTPGFCFDILCTDQPII 252
            |.|..|:|:.||..|...|.||.:|.||:|:.  ...||:|:|.|.|:.....|:|:||||.|::
Mouse   226 GFFLGRIDYQDKLNRKKKLRMEELWRASDSLEPPAADLFTGVLPNNYNPPKYLCWDVLCTDPPVV 290

  Fly   253 DGD-SEENNVKQRVDDFISYAKNVSEVYITNHIMVPMGGDFQYEDAKVNYKNMDKLIKYINERQA 316
            |.. |.|.|.|..|:.|:..|.:....|.|||.::.||.||.||:|.:.:|||||||:.:|.:|.
Mouse   291 DNPRSPEFNAKTLVNYFLKLASSQKGFYRTNHTVMTMGSDFHYENANMWFKNMDKLIRLVNAQQV 355

  Fly   317 SGSKYNIFYSTPSCYLNSLHQSLESWPNKTQDFFPYAHEKNSFWTGFFTSRPTQKRFERDGNHML 381
            :||..::.||||:|||..|:::..:|..|..||||||...:.||||:|:|||..||:||...:.|
Mouse   356 NGSLVHVLYSTPTCYLWELNKANLTWTVKEDDFFPYADGPHMFWTGYFSSRPALKRYERLSYNFL 420

  Fly   382 QVAKQLSVLANLTSEEHKI------DLDYLRQVMGVMQHHDAITGTEKQAVSDDYDRMM------ 434
            ||..||..   |...|..:      |...|::.|.|:|||||::||.:|.|.:||.|.:      
Mouse   421 QVCNQLEA---LVGPEANVGPYGSGDSAPLQEAMAVLQHHDAVSGTARQNVVNDYARQLAAGWGP 482

  Fly   435 YEAIVGASNNARDALRLLTNMPYGEFESCLRLNISECAFTKDGADNVLVTLYNPLAHSSTQYVRI 499
            .|.:|.      :||..|::... .|..|..||||.|..::. ::...|||||||.....|.||:
Mouse   483 CEVLVS------NALARLSHYKQ-NFSFCRELNISICPVSQT-SERFQVTLYNPLGRKVDQMVRL 539

  Fly   500 PVKEENYQVTDEKGRTVPSEVVPVPWQVLALEYRSNDTQHELVFKATVNKV--SSYSIKKVESSE 562
            ||.|.|:.|.|...:.:.|.||.||      .|.|...|.||:|.|:|..:  |:||:.|:  |:
Mouse   540 PVYEGNFIVKDPHDKNISSNVVMVP------SYYSETYQWELLFPASVPALGFSTYSVAKM--SD 596

  Fly   563 VKHSSIKKIN-PREDNNSET-VVENSVVKLVMDNHTG---RLKSVEMNGVSEKIVQNFGVY---- 618
            :.|.:...:: ||:..:... |:||..::...|:.||   :::::|.| :|..:.|.|..|    
Mouse   597 LNHQAHNLLSRPRKHKSHHVLVIENKYMRATFDSGTGLLMKIENLEQN-LSLPVSQGFFWYNASV 660

  Fly   619 ----KSHTSCAYTFRQD-GDIELFENDFEFTVYEGSLVKEVHQHVNDWISQVIRIYEGVSRVELE 678
                .|..|.||.||.: |.........:.::.:.:||:||||:.:.|.|||||:|:|...:|||
Mouse   661 GDEESSQASGAYIFRPNVGKPIPVSRWAQISLVKTALVQEVHQNFSAWCSQVIRLYKGQRHLELE 725

  Fly   679 WMVGPIPIDDKLGSEFVTNFKSEISSNGVFYTDSNGRELMKRVKDKREDFVSDLSRQPVSGNFYP 743
            |.|||||:.|..|.|.::.|.:.:.:.|.|:|||||||::||..|.|..:..: ..:||:||:||
Mouse   726 WTVGPIPVRDDWGKEVISRFDTPMKTKGQFFTDSNGREILKRRDDYRPTWTLN-QTEPVAGNYYP 789

  Fly   744 VTSRIALQDDTKRLVLLNDRSQGGASLEDGALEMLIHRRHLFNDGGGVGEALNETQYGKGLIARG 808
            |.:||.:.|...:|.:|.||||||:||:||:||:::|||.|.:|..||.|.|.||..|..:  ||
Mouse   790 VNTRIYITDGQMQLTVLTDRSQGGSSLQDGSLELMVHRRLLVDDDRGVSEPLLETDTGDKV--RG 852

  Fly   809 KLYLILDSATDGDTVTERKTEKELFLPFWKFFSKTGGVEITPSKSLP--DFN----DLPQSVHLL 867
            :..::|.|.:|.........|:|:..|  :.....||.....|::.|  .|:    :||..||||
Mouse   853 RHLVLLSSVSDAAARHRLLAEQEVLAP--QVVLSLGGSSPYHSRATPKTQFSGLRQELPPQVHLL 915

  Fly   868 TLEFFSEQEILIRFEHFL------DKSEGRVISFNIRDIFDSLGGLAIRETTLDGNMPLSDMKRF 926
            ||..:..:.:|:|.||..      |::....::.|::::|.:.....::||||..|.|||...|.
Mouse   916 TLARWGPKMLLLRLEHQFALKEDSDRNLSSPVTLNVQNLFQTFTINYLQETTLAANQPLSRASRL 980

  Fly   927 KFHAQESGTKPSSVEYSTAQHKPLEAVKSDEASLFAVTLYPMQIRTFIIKTE 978
            |:   .:.|.|:|..         |..|.|..|   |||.||:||||:...:
Mouse   981 KW---MTNTGPTSYP---------EPSKLDPTS---VTLKPMEIRTFLASVQ 1017

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 145/287 (51%)
Alpha-mann_mid 359..434 CDD:214875 35/81 (43%)
Glyco_hydro_38C 483..973 CDD:285047 185/518 (36%)
Man2b1XP_006530810.1 GH38N_AMII_LAM_like 63..352 CDD:212121 146/289 (51%)
Alpha-mann_mid 398..476 CDD:214875 35/81 (43%)
Glyco_hydro_38C 521..1012 CDD:285047 185/520 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64844455
eggNOG 1 0.900 E1_KOG1959
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S4230
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D201312at2759
OrthoFinder 1 1.000 FOG0001898
OrthoInspector 1 1.000 T616153
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11607
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
109.760

Return to query results.
Submit another query.