DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and Man2a1

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_032575.2 Gene:Man2a1 MGIID:104669 Length:1150 Species:Mus musculus

Alignment Length:1064 Identity:267/1065 (25%)
Similarity:455/1065 (43%) Gaps:207/1065 (19%)


  Fly    38 VNIHLVPHSHNDVGWLKTVDQSYYGYKNKIHHAGVQYILDSVVSQLLQDPKRRFIQVETAFFAKW 102
            :.:.:|||||||.|||||.: .|:..|       .|||.:::|.:|.:|..|:|:..|.::.|||
Mouse   165 LQVFVVPHSHNDPGWLKTFN-DYFRDK-------TQYIFNNMVLKLKEDSSRKFMWSEISYLAKW 221

  Fly   103 WNVQSESMKKVVTKLVNEGRFEFTGGAWSMNDEANVNYQGVIDQFTVGLKFLNETFGSCGRPRVG 167
            |::.....|:.|..|:..|:.|...|.|.|.|||..:|..:|||...|.::|.:..|.  :||.|
Mouse   222 WDIIDIPKKEAVKSLLQNGQLEIVTGGWVMPDEATPHYFALIDQLIEGHQWLEKNLGV--KPRSG 284

  Fly   168 WQIDTFGHSREQAAIFAHMGYDGQFFSRMDHNDKDTRMNDLTMEMIWDASESMSGVSLFSGMLYN 232
            |.||.||||...|.:....|:......|:.:..|.......|:|..|..:..:...:.....:..
Mouse   285 WAIDPFGHSPTMAYLLKRAGFSHMLIQRVHYAIKKHFSLHKTLEFFWRQNWDLGSATDILCHMMP 349

  Fly   233 FYS-DTPGFC---------FDIL--------C----TDQPIIDGDSEENNVKQRVDDFISYAKNV 275
            ||| |.|..|         ||..        |    ..:.|..|     ||:.|....:...:..
Mouse   350 FYSYDIPHTCGPDPKICCQFDFKRLPGGRYGCPWGVPPEAISPG-----NVQSRAQMLLDQYRKK 409

  Fly   276 SEVYITNHIMVPMGGDF---QYEDAKVNYKNMDKLIKYINERQASGSKYNIFYSTPSCYLNSLHQ 337
            |:::.|..::.|:|.||   :|.:..:..:|.::|..|:|.:  ...|..|.:.|.|.|.::|.:
Mouse   410 SKLFRTKVLLAPLGDDFRFSEYTEWDLQCRNYEQLFSYMNSQ--PHLKVKIQFGTLSDYFDALEK 472

  Fly   338 SLES--------WPNKTQDFFPYAHEKNSFWTGFFTSRPTQKRFERDGNHMLQVAKQLSVLANLT 394
            ::.:        :|..:.|||.||...:.:|:|:|||||..||.:|.....::.|:.|..||...
Mouse   473 AVAAEKKSSQSVFPALSGDFFTYADRDDHYWSGYFTSRPFYKRMDRIMESRIRAAEILYQLALKQ 537

  Fly   395 SEEHKID----------LDYLRQVMGVMQHHDAITGTEKQAVSDDYDRMMYEAIVGASNNARDAL 449
            ::::||:          |...|:.:|:.|||||||||.|..|..||...:::::........|:.
Mouse   538 AQKYKINKFLSSPHYTTLTEARRNLGLFQHHDAITGTAKDWVVVDYGTRLFQSLNSLEKIIGDSA 602

  Fly   450 RLLTNMPYGEFES-----CLRLNISECAFTKDGADNVL---------------VTLYNPLAHSST 494
            .||.......::|     .|.::      ||..:.:.|               :.:|||......
Mouse   603 FLLILKDKKLYQSDPSKAFLEMD------TKQSSQDSLPQKIIIQLSAQEPRYLVVYNPFEQERH 661

  Fly   495 QYVRIPVKEENYQVTDEKGRTVPSEVVPVPWQVLALEYRS-NDTQHELVFKATVNKVSSYSIKKV 558
            ..|.|.|.....:|..:.|:.|..:|..| |.    :.|: :...:|:.|.|.:..:.....|.:
Mouse   662 SVVSIRVNSATVKVLSDSGKPVEVQVSAV-WN----DMRTISQAAYEVSFLAHIPPLGLKVFKIL 721

  Fly   559 ESSEVKHSSIKKINPREDNNSETVVENSV--VKLVMDNHTGRLKSVE---------MNGVSEKIV 612
            ||    .||...:......|::.:.||.:  ||.::|  .|...::|         .:|:.||:.
Mouse   722 ES----QSSSSHLADYVLYNNDGLAENGIFHVKNMVD--AGDAITIENPFLAIWFDRSGLMEKVR 780

  Fly   613 QN--------------FG-VYKSHTSCAYTFRQDGDIELFEN---DFEFTVYEGSLVKEVH---Q 656
            :.              :| ..|...|.||.|..||..:.:.:   .| ..|..|.:..:|.   :
Mouse   781 RKEDSRQHELKVQFLWYGTTNKRDKSGAYLFLPDGQGQPYVSLRPPF-VRVTRGRIYSDVTCFLE 844

  Fly   657 HVNDWISQVIRIY--EGVSRVELEWMVGPIPIDDKLGSEFVTNFKSEISSNGVFYTDSNGRELMK 719
            ||    :..:|:|  :|:....:| :...:.|.:....|.|....|:|::...:|||.||.::..
Mouse   845 HV----THKVRLYNIQGIEGQSME-VSNIVNIRNVHNREIVMRISSKINNQNRYYTDLNGYQIQP 904

  Fly   720 RVKDKREDFVSDLSRQPVSGNFYPVTSRIALQDDTKRLVLLNDRSQGGASLEDGALEMLIHRRHL 784
            |         ..:|:.|:..|.||:.:...:||...||.||:.:|.|.:|:..|.:|:.:.||.:
Mouse   905 R---------RTMSKLPLQANVYPMCTMAYIQDAEHRLTLLSAQSLGASSMASGQIEVFMDRRLM 960

  Fly   785 FNDGGGVGEALNETQYGKGLIARGKLYLILDSATDGDTVTERKTE---------------KELFL 834
            .:|..|:|:.:::.:     |......::|:..:..:...|:|:.               ...||
Mouse   961 QDDNRGLGQGVHDNK-----ITANLFRILLEKRSAVNMEEEKKSPVSYPSLLSHMTSSFLNHPFL 1020

  Fly   835 PFWKFFSKTGGVEITPSKSLPDF----NDLPQSVHLLTL--------EFFSEQEILIRFEHFLDK 887
            |    ...:|.:.....:.|.:|    :.||..:||:.|        :.:|::..||......| 
Mouse  1021 P----MVLSGQLPSPAFELLSEFPLLQSSLPCDIHLVNLRTIQSKMGKGYSDEAALILHRKGFD- 1080

  Fly   888 SEGRVISFNIRDIFDSLGGLAIRETTLDGNMPLSDMKRFKFHAQESGTKPSSVEYSTAQHKPLEA 952
                 ..|:.|       |:.:..:|..|.|  |.:|.|...|.|| ..|||:   :..|.|.:|
Mouse  1081 -----CQFSSR-------GIGLPCSTTQGKM--SVLKLFNKFAVES-LVPSSL---SLMHSPPDA 1127

  Fly   953 VKSDEASLFAVTLYPMQIRTFIIK 976
            ....|     |:|.||:|.||.|:
Mouse  1128 QNMSE-----VSLSPMEISTFRIR 1146

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 86/298 (29%)
Alpha-mann_mid 359..434 CDD:214875 32/85 (38%)
Glyco_hydro_38C 483..973 CDD:285047 126/552 (23%)
Man2a1NP_032575.2 PLN02701 127..1148 CDD:178304 267/1065 (25%)
GH38N_Man2A1 164..507 CDD:212131 101/359 (28%)
Alpha-mann_mid 502..587 CDD:214875 32/85 (38%)
Glyco_hydro_38C 757..1143 CDD:285047 98/434 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.