DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and Man2a2

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_766491.2 Gene:Man2a2 MGIID:2150656 Length:1152 Species:Mus musculus

Alignment Length:1075 Identity:276/1076 (26%)
Similarity:445/1076 (41%) Gaps:226/1076 (21%)


  Fly    38 VNIHLVPHSHNDVGWLKTVDQSYYGYKNKIHHAGVQYILDSVVSQLLQDPKRRFIQVETAFFAKW 102
            :.:.:|||||||.||:||.|: ||..:       .|:||:|:||:|.:||:|||:..|.:|||||
Mouse   166 LQVFVVPHSHNDPGWIKTFDK-YYTEQ-------TQHILNSMVSKLQEDPRRRFLWAEVSFFAKW 222

  Fly   103 WNVQSESMKKVVTKLVNEGRFEFTGGAWSMNDEANVNYQGVIDQFTVGLKFLNETFGSCGRPRVG 167
            |:..|...:..|.:||..|:.|...|.|.|.||||.:|..::||...|.::|....|:  .||.|
Mouse   223 WDNISAQKRAAVRRLVGNGQLEIATGGWVMPDEANSHYFALVDQLIEGHQWLERNLGA--TPRSG 285

  Fly   168 WQIDTFGHSREQAAIFAHMGYDGQFFSRMDHNDKD----TRMNDLTMEMIWDASESMSGVSLFSG 228
            |.:|.||||.....:............|:.:..|.    |...:.....:||   |.|...:|..
Mouse   286 WAVDPFGHSSTMPYLLRRANLTSMLIQRVHYAIKKHFAATHSLEFMWRQMWD---SDSSTDIFCH 347

  Fly   229 MLYNFYS-DTPGFCF---DILCT-DQPIIDGDS------------EENNVKQRVDDFISYAKNVS 276
            |: .||| |.|..|.   .|.|. |...:.|..            .|.||..|....:...:..|
Mouse   348 MM-PFYSYDVPHTCGPDPKICCQFDFKRLPGGRINCPWKVPPRAITEANVADRAALLLDQYRKKS 411

  Fly   277 EVYITNHIMVPMGGDFQYE-----DAKVNYKNMDKLIKYINER-----QASGSKYNIFYSTPSCY 331
            .::.:|.::||:|.||:|:     ||:  :.|..:|..::|.:     ||.       :.|.|.|
Mouse   412 RLFRSNVLLVPLGDDFRYDKPQEWDAQ--FFNYQRLFDFLNSKPEFHVQAQ-------FGTLSEY 467

  Fly   332 LNSLHQSL--------ESWPNKTQDFFPYAHEKNSFWTGFFTSRPTQKRFERDGNHMLQVAKQLS 388
            .::|::..        ..:|..:.|||.||..::.:|||::||||..|..:|.....|:.|:.|.
Mouse   468 FDALYKRTGVEPGARPPGFPVLSGDFFSYADREDHYWTGYYTSRPFYKSLDRVLEAHLRGAEILY 532

  Fly   389 VLA-------NLTSEEHKIDLDYL---RQVMGVMQHHDAITGTEKQAVSDDYDRMMYEAIVGASN 443
            .||       .|..:....|...|   |:.:|:.|||||||||.|:||..||...:..::|....
Mouse   533 SLALAHARRSGLAGQYPLSDFALLTEARRTLGLFQHHDAITGTAKEAVVVDYGVRLLRSLVSLKQ 597

  Fly   444 ---NARDALRLLTNMPYGEFESCLRLNISECAFTKDG----------ADNVLVTLYNPLAHSSTQ 495
               ||...|.|.....|........|.:.:...:.|.          :....|.::|||......
Mouse   598 VIINAAHYLVLGDQETYSFDPGTPFLQMDDSRVSHDALPERTVIRLDSSPRFVVVFNPLEQERLS 662

  Fly   496 YVRIPVKEENYQVTDEKGRTVPSEV----------------VPVPWQVLALEYRSNDTQHEL--- 541
            .|.:.|.....:|..|:|:.:..::                |.||.::..|.......|.:|   
Mouse   663 VVSLLVNSPRVRVLSEEGQPLSVQISVHWSSATDMVPDVYQVSVPVRLPGLGLGVLQLQPDLDGP 727

  Fly   542 --------VF----KATVNKVSSYSIKKVESSEVKHSSIKKINPREDNNSETVVENSVVKLVMDN 594
                    |:    |.:|::.|::.::.|:|..                |:..:.|..:::....
Mouse   728 YTLQSSVRVYLNGVKLSVSRQSAFPVRVVDSGA----------------SDFAISNRYMQVWFSG 776

  Fly   595 HTGRLKSVEMNGVSEKIVQ----NFGVYKSHT----SCAYTFRQDGDIELF--ENDFEFTVYEGS 649
            .||.|||:..  |.|:..|    .|.||.:.|    |.||.|..|.:.:.:  :......|.||.
Mouse   777 LTGLLKSIRR--VDEEQEQQMELEFLVYGTRTSKDKSGAYLFLPDSEAKPYVPKKPPVLRVTEGP 839

  Fly   650 LVKEV---HQHVNDWISQVIRIYE--GVSRVELEWMVGPIPIDDKLGSEFVTNFKSEISSNGVFY 709
            ...||   ::|.:    ||||:|.  ||..:.|: |...:.|.|.:..|......::|.|.|.|:
Mouse   840 FFSEVAVYYEHFH----QVIRLYNLPGVEGLSLD-MSFQVDIRDYVNKELALRIHTDIDSQGTFF 899

  Fly   710 TDSNGRELMKRVKDKREDFVSDLSRQPVSGNFYPVTSRIALQDDTKRLVLLNDRSQGGASLEDGA 774
            ||.||.::..|         ..|.:.|:..||||:.....:||..:||.|...::.|.:||.:|.
Mouse   900 TDLNGFQIQPR---------QYLKKLPLQANFYPMPVMAYIQDSQRRLTLHTAQALGVSSLGNGQ 955

  Fly   775 LEMLIHRRHLFNDGGGVGEALNETQYGKGLIARGKLYLILDSATDGDTVTERKTEKE-------- 831
            ||:::.||.:.:|..|:|:.|.:.:     |...:..|:|:..|.......::.|:.        
Mouse   956 LEVILDRRLMQDDNRGLGQGLKDNK-----ITCNRFRLLLERRTTMSPEVHQEQERSTSYPSLLS 1015

  Fly   832 -----------LFLPFWKFFSKTGGVEITPSKSLPDFNDLPQSVHLLTLEFF--------SEQEI 877
                       |.||    .:|..|.........|..:.||...|||.|...        ::..:
Mouse  1016 HLTSMYLSTPPLVLP----VAKRQGTSPALRSFHPLASPLPCDFHLLNLRMLPAEDTLPATDSAL 1076

  Fly   878 LIRFEHFLDKSEGRVISFNIRDIFDSLGGLAIRETTLDGNMPLSDMKRFKFHAQE-SGTKPSSVE 941
            ::..:.|....|.:.:.||.              ||..|.:.|..:    ||..: :..:|:|:.
Mouse  1077 ILHRKGFDCGLEAKNLGFNC--------------TTSQGKLALGSL----FHGLDVTFLQPTSLT 1123

  Fly   942 YSTAQHKPLEAVKSDEASLFAVTLYPMQIRTFIIK 976
            .......|..:..        ::|.||:|.||.::
Mouse  1124 LLYPLASPSNSTD--------ISLEPMEISTFRLR 1150

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 96/299 (32%)
Alpha-mann_mid 359..434 CDD:214875 33/85 (39%)
Glyco_hydro_38C 483..973 CDD:285047 125/564 (22%)
Man2a2NP_766491.2 PLN02701 140..1151 CDD:178304 276/1076 (26%)
CE4_SF 165..508 CDD:301698 112/365 (31%)
Alpha-mann_mid 503..588 CDD:214875 33/85 (39%)
Glyco_hydro_38C 752..1147 CDD:285047 106/462 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.