DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and man2a2

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:XP_009296075.1 Gene:man2a2 ZFINID:ZDB-GENE-110331-1 Length:1174 Species:Danio rerio

Alignment Length:1091 Identity:272/1092 (25%)
Similarity:444/1092 (41%) Gaps:236/1092 (22%)


  Fly    38 VNIHLVPHSHNDVGWLKTVDQSYYGYKNKIHHAGVQYILDSVVSQLLQDPKRRFIQVETAFFAKW 102
            :.:.:|||||||.||:||.|: ||..:       .|:||:::|:::.:||:|:||..|.::||||
Zfish   166 LQVFVVPHSHNDPGWIKTFDK-YYNDQ-------TQHILNNMVTKMAEDPRRKFIWSEISYFAKW 222

  Fly   103 WNVQSESMKKVVTKLVNEGRFEFTGGAWSMNDEANVNYQGVIDQFTVGLKFLNETFGSCGRPRVG 167
            |.......::|:.||:..|:.|...|.|.|.||||.:|..:|||...|.::|....|.  .||.|
Zfish   223 WESADVHKQEVMRKLILSGQLEMVTGGWVMTDEANAHYFAMIDQLIEGHQWLERNLGV--TPRSG 285

  Fly   168 WQIDTFGHSREQAAIFAHMGYDGQFFSRMDHNDKD----TRMNDLTMEMIWDASESMSGVSLFSG 228
            |.:|.||||.....:............|:.::.|.    ||..:......||..   |...:|..
Zfish   286 WAVDPFGHSATMPYLLKRANISSMLIQRVHYSIKKHFAATRSLEFMWRQAWDIE---SSTDMFCH 347

  Fly   229 MLYNFYS-DTPGFCF---DILCT-DQPIIDGDS------------EENNVKQRVDDFISYAKNVS 276
            |: .||| |.|..|.   .|.|. |...:.|..            .:.||.:|....:...:..|
Zfish   348 MM-PFYSYDVPHTCGPDPKICCQFDFKRLPGSRVNCPWKVPPRAINDANVAERAGVLLDQYRKKS 411

  Fly   277 EVYITNHIMVPMGGDFQYEDA---KVNYKNMDKLIKYINERQASGSKYNIFYSTPSCYLNSLHQS 338
            :::.:..::||:|.||:|:.|   ...|.|..||..|:|.......|..  ::|.|.|.::::::
Zfish   412 KLFRSKVLLVPLGDDFRYDKALEWDQQYLNYQKLFDYMNSHPEMHVKAQ--FATLSDYFDAVYKA 474

  Fly   339 --------LESWPNKTQDFFPYAHEKNSFWTGFFTSRPTQKRFERDGNHMLQVAKQLSVLANLTS 395
                    ...:|..:.|||.||..::.:|:|::||||..|..:|.....|:.|:.|..||...:
Zfish   475 NGVTSGARPPDYPVLSGDFFAYADREDHYWSGYYTSRPFYKNLDRILESHLRGAEILYSLAVAHA 539

  Fly   396 EEHKID-----LDY-----LRQVMGVMQHHDAITGTEKQAVSDDYDRMMYEAIVGASN---NA-- 445
            ....::     .||     .|:.:|:.|||||||||.|:||..||...:..::||...   ||  
Zfish   540 RHAGVEGRYPVSDYSLLTDARRNIGLFQHHDAITGTAKEAVVIDYGNRLLRSLVGLKRVIINAAH 604

  Fly   446 ------RDALRLLTNMPYGEFESCLRLNISECAFTKDG-ADNVLV---------TLYNPLAHSST 494
                  :|..|.....|:        |...:...|:|. ....|:         .|:||:.....
Zfish   605 FLIIKNKDIYRFYQTEPF--------LETDDRRATQDSLPQRTLIELESSPRYLVLFNPVEQERL 661

  Fly   495 QYVRIPVKEENYQVTDEKGRTVPSEVVPVPWQVLALEYRSNDTQHELVFKATV------------ 547
            ..|.:.|.....:|..|.|:|:|.:        |:.::.|.......|::|:.            
Zfish   662 CLVTVLVNSARVRVLTEDGQTLPVQ--------LSAQWMSATEMSGEVYQASFMARLPALGLAVF 718

  Fly   548 ---------NKVSSYSIKKVESSEVKHSSIKKINPREDNNSETV------VENSVVKLVMDNHTG 597
                     ..:.|.::.:|..   :..||:.::|. ...|:||      :::..:.|.....||
Zfish   719 HLYDSADSPMTLRSETLLRVPG---RGQSIRGLDPL-PVRSQTVDGQPFYIQSQSLTLGFSGATG 779

  Fly   598 RLKSVEMNGVSEKI-VQ----NFGVYKS-HTSCAYTFRQDGDIELFENDFE--FTVYEGSLVKEV 654
            .|:|:......::: ||    .:|...| ..|.||.|..||:.:.:.....  ..|.||.|..||
Zfish   780 LLESIRRKDDPQEVRVQIQFLTYGTRPSKDKSGAYLFLPDGNAKPYSQREAPIVRVVEGPLFAEV 844

  Fly   655 HQHVNDWISQVIRIYE--GVSRVELEWMVGPIPIDDKLGSEFVTNFKSEISSNGVFYTDSNGREL 717
            ..|...: .|.:||:.  ||..:.|: :...:.|.|:...|....|.::|.|...||||.||.::
Zfish   845 VAHYQHF-QQTVRIHNVPGVDGLSLD-ITTMVDIRDQNNKELAMRFVTDIQSGDTFYTDLNGFQI 907

  Fly   718 MKRVKDKREDFVSDLSRQPVSGNFYPVTSRIALQDDTKRLVLLNDRSQGGASLEDGALEMLIHRR 782
            ..|         ....:.|:..||||:.|...:||...||.|...::.|..||..|.||:::.||
Zfish   908 QPR---------RYFQKLPLQANFYPMPSTAYIQDSQYRLTLHTAQALGVTSLASGQLEVILDRR 963

  Fly   783 HLFNDGGGVGEALNETQYGKGLIARGKLYLILDSATD--------------------GDTVTERK 827
            .:.:|..|:|:.|.:.:.     ...:..|:|:..::                    ||...|..
Zfish   964 LMQDDNRGLGQGLKDNKR-----TANRFRLLLERRSNSAKPAGSYANMLNKIIAGILGDGQEEPV 1023

  Fly   828 TEKELFLPFWKFFS---------KTGGVEITPSKS--------LPDFNDLPQSVHLLTLEFFSEQ 875
            ..:.:..|  ...|         :...:.:.|.|.        .|....||...|||.|......
Zfish  1024 DSRPVSFP--SLLSHMTSTILNHEVLALPVLPRKHGVPPMRTFAPLAGTLPCDFHLLNLRSIQSP 1086

  Fly   876 E---------ILIRFEHFLDKS-EGRVISFNIRDIFDSLGGLAIRETTLDGNMPLSDMKRFKFHA 930
            :         .|:.....||.. |.:...||.              ||..|.:.:|.:.|     
Zfish  1087 QDAHSPSPYMALLLHRLGLDCGLEPQNPGFNC--------------TTTQGQLSVSGLFR----- 1132

  Fly   931 QESG-----TKPSSVEYSTAQHKPLEAVKSDEASLFAVTLYPMQIRTFIIK 976
               |     .:|.|:....:| .||    |:::|   |:|.||:|..:.:|
Zfish  1133 ---GLDLQLLQPMSLSLMHSQ-PPL----SNDSS---VSLEPMEISAYKLK 1172

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 92/297 (31%)
Alpha-mann_mid 359..434 CDD:214875 31/85 (36%)
Glyco_hydro_38C 483..973 CDD:285047 126/588 (21%)
man2a2XP_009296075.1 PLN02701 128..1173 CDD:178304 272/1092 (25%)
CE4_SF 165..508 CDD:301698 105/358 (29%)
Alpha-mann_mid 503..588 CDD:214875 31/85 (36%)
Glyco_hydro_38C 741..1169 CDD:285047 110/477 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.