DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and man2b2

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_001106515.1 Gene:man2b2 XenbaseID:XB-GENE-1006292 Length:990 Species:Xenopus tropicalis

Alignment Length:1093 Identity:287/1094 (26%)
Similarity:477/1094 (44%) Gaps:237/1094 (22%)


  Fly    12 ILLVLFAKQSEAVCGYESCPETKANMVNIHLVPHSHNDVGWLKTVDQSYYGYKNKIHHAGVQYIL 76
            :||||.:... .||.:.:.|      :...::||||.||||:.||.:|.:.|...::        
 Frog     3 VLLVLLSAWG-CVCTHSAQP------IQAFVIPHSHMDVGWVYTVQESMHAYAANVY-------- 52

  Fly    77 DSVVSQLLQDPKRRFIQVETAFFAKWWNVQSESM-KKVVTKLVNEGRFEFTGGAWSMNDEANVNY 140
            .:||.:|::..:||||.||..||..||.:.:.:: |:.|.:|:.|||.||..|...|:|||....
 Frog    53 TTVVEELMRGDRRRFIVVEQEFFRLWWKLFAGNVEKQQVHQLMREGRLEFVIGGQVMHDEALTTI 117

  Fly   141 QGVIDQFTVGLKFLNETFGSCGRPRVGWQIDTFGHSREQAAIFAHMGYDGQFFSRMDHNDKDTRM 205
            ...|.|.|.|..|:.||||.  |||..|.:|.||.|.....:||..|::|...||:|::.|....
 Frog   118 DDQILQLTEGHGFIYETFGV--RPRFSWHVDPFGASAASPTLFAMAGFNGHLISRIDYDTKADMQ 180

  Fly   206 NDLTMEMIWDASESMSG-VSLFSGML--YNF-------YSDTPGFCFD-ILCTDQPIIDGDSEEN 259
            |...::.||.||.|:|. ..:|:.::  |::       :||..||.:: |.....|..||.....
 Frog   181 NGKELQFIWRASPSLSDKQEIFTHVMDQYSYCTPSYIPFSDRSGFYWNGIAVFPDPPKDGMYPNM 245

  Fly   260 NVKQRVDDFISYA----KNVSE---VYITNHIMVPMGGDFQYEDAKVNYKNMDKLIKYINERQAS 317
            ::....|....||    ||:.|   .:.::.::.|.|.|.|:.:|.|.:.|||.|:.|||:....
 Frog   246 SLPVTADTIHPYAETMVKNIKERAAWFRSSDVLWPWGCDKQFFNASVQFNNMDLLLDYINKHTEF 310

  Fly   318 GSKYNIFYSTPSCYLNSLHQSLESWPNK-TQDFFPYAHEKNSFWTGFFTSRPTQKRFERDGNHML 381
            |  ..:.|||...|..:|:....:|..: :|||.||:.:.:..||||:|||...|...|..:.:|
 Frog   311 G--VTVQYSTLGDYFKNLYNRNLTWGLRGSQDFLPYSSDSSQAWTGFYTSRNVLKGVARRASSLL 373

  Fly   382 QVAKQL---SVLANLTSEEHKI----DLDYLRQVMGVMQHHDAITGTEKQAVSDDYDRMMYEAIV 439
            ..|:..   .:|.:.|....|:    .|..||..:..:||||.|||||...|.|.|   :...:.
 Frog   374 YAAESAFAQHLLKHPTGSVEKVWAMEQLRSLRWAVSEVQHHDGITGTESPKVRDMY---IANLLQ 435

  Fly   440 GASNNARDALRLLTNMPYGEFESCLRLNISECAFTKDGADNVLVTLYNPLAHSSTQYVRIPVKEE 504
            ||:...:....::.::...:..||             |...:.:|:|||||...|.:|.:|:...
 Frog   436 GAAGVRKLMAAIVMDLYSSQANSC-------------GNGYINITVYNPLAWDVTTFVLVPMNNS 487

  Fly   505 NYQVTDEKGRTVPSEVVPVPWQVLALEYRSNDTQ-------HELVFKATVNKVS--SYSIK---- 556
            ...|.|:.|:.||:::             .|.|:       |.||   |:..:|  .||||    
 Frog   488 VSGVYDKFGQPVPAQI-------------QNATEPSNAFDLHILV---TLKGLSYGRYSIKLGSC 536

  Fly   557 ------KVESSEVKHSSIKKINPREDNNSETVVENSVVKLVMDNHTGRLKSVEMNGVSE--KIVQ 613
                  .|...::......|.|..:..|..|.:.|....:|:|.:|..|.|:.....::  ::.|
 Frog   537 DAANDRLVTGRKITFVRQPKRNKAKRQNLVTPIMNDCYTVVIDQNTNLLHSITARESNQTVQVTQ 601

  Fly   614 NFGVYKSHTSCAYTFRQDGDIEL--FENDFEFT---------------VYEGSLVKEVHQHVNDW 661
            .|..|.|          :|||..  ..:::.||               :..|.||.|:.|:....
 Frog   602 EFLEYHS----------NGDISKGPISDNYLFTSTGPAISAYKAVGLEIIAGKLVTEIRQYFYSN 656

  Fly   662 I----------SQVIRIYEGVSR------VELEWMVGPIPIDDKLGSEFVTNFKSEISSNGVFYT 710
            |          |::..:.||..:      :|..:.|||:    .|..|.:....:::.::.:.||
 Frog   657 ITAQTYLYAVYSRIYNVPEGYDKSLVCHHIEQSYRVGPM----DLNRESIIRTSTDLRTDRLIYT 717

  Fly   711 DSNGRELMKRVKDKREDFVSDLSRQPVSGNFYPVTSRIALQDDTKRLVLLNDRSQGGASLEDGAL 775
            |:||.::.:| :.|..|      ...|:.|:||:.....::|::.|||.|::|:.|.:|.::|.:
 Frog   718 DNNGYQMQRR-QFKNYD------TNTVARNYYPMVRTAYIEDNSTRLVFLSERAHGVSSQDNGEV 775

  Fly   776 EMLIHRRHLFND---GGGVGEALNETQYGKGLIARGKLYLILDSATDGDTVTER----------- 826
            |:::||| |:|:   .......||:|.     :.|..::|:|.|......:.:|           
 Frog   776 EIMLHRR-LWNNLEWDLNYNLTLNDTS-----VVRPTIWLMLGSRALAGALYQRLGMALEHRPLV 834

  Fly   827 ----KTEKELFLPFWKFFSKTGGVEITPSKSLPDFNDLPQSVHLLTLE----FFSEQ-------- 875
                .|.:|      |...||..:.||          ||.::||..|.    |:|.:        
 Frog   835 IYSLHTGQE------KRSYKTTDLPIT----------LPDNIHLQILSIPGWFYSSRHHEHMQDI 883

  Fly   876 -------------EILIRFEHFLDKSEGRVIS----FNIRDIFDSLGGLA-IRETTLDGNMPLSD 922
                         .:|:|.:|..:.:|..|:|    .|::.:...||.:: :.|.:|.|...:..
 Frog   884 HTGNIRDNVADFHRVLLRLQHLYETNEDPVLSKPVTINLQSLLKGLGTVSLVEERSLTGTWDIHT 948

  Fly   923 MKRFKFHAQESGTKPSSVEYSTAQHKPLEAVKSDEASLFAVTLYPMQIRTFII 975
            :||:|:.|...||........|:.              |.:||.|.:|||..:
 Frog   949 LKRWKWKANIKGTDQREHTLGTSD--------------FTITLSPKEIRTLFV 987

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 98/292 (34%)
Alpha-mann_mid 359..434 CDD:214875 29/82 (35%)
Glyco_hydro_38C 483..973 CDD:285047 135/592 (23%)
man2b2NP_001106515.1 GH38N_AMII_Epman_like 22..346 CDD:212122 111/336 (33%)
Alpha-mann_mid 352..433 CDD:214875 29/84 (35%)
Glyco_hydro_38C 567..985 CDD:285047 106/475 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D201312at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.