DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and man2a1

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:NP_001163963.1 Gene:man2a1 XenbaseID:XB-GENE-961025 Length:1150 Species:Xenopus tropicalis

Alignment Length:1070 Identity:276/1071 (26%)
Similarity:446/1071 (42%) Gaps:220/1071 (21%)


  Fly    38 VNIHLVPHSHNDVGWLKTVDQSYYGYKNKIHHAGVQYILDSVVSQLLQDPKRRFIQVETAFFAKW 102
            :.:.||||||||.|||||.|..:        ....|:||:::|.:|.:|..|:|:..|.::|:||
 Frog   168 LQVFLVPHSHNDPGWLKTFDDYF--------RDQTQHILNNMVIKLQEDKNRKFMWSEISYFSKW 224

  Fly   103 WNVQSESMKKVVTKLVNEGRFEFTGGAWSMNDEANVNYQGVIDQFTVGLKFLNETFGSCGRPRVG 167
            |:......|:.|.:|:...:||...|.|.|.|||..:|..::||...|.::|.:..|.  :|:.|
 Frog   225 WDGIDNQKKEAVKRLIELEQFEIVTGGWVMPDEATPHYFSLVDQLIEGHQWLEKNLGV--KPKSG 287

  Fly   168 WQIDTFGHSREQAAIFAHMGYDGQFFSRMDHNDKDTRMNDLTMEMIWDASESMSGVSLFSGMLYN 232
            |.||.||||...|.|....|.......|:.::.|....:..|:|..|..:..:...:.....:..
 Frog   288 WAIDPFGHSPTMAYILKSSGLSNMLIQRVHYSIKKYFASKQTLEFFWRQNWDLGHSTDILCHMMP 352

  Fly   233 FYS-DTPGFC---------FD--------ILC---TDQPIIDGDSEENNVKQRVDDFISYAKNVS 276
            ||| |.|..|         ||        :.|   ....:|:    |.||:.|....:...:..|
 Frog   353 FYSYDVPHTCGPDPKICCQFDFKRLPGSRVSCPWRVPPEVIN----EGNVQHRAWMILDQYRKKS 413

  Fly   277 EVYITNHIMVPMGGDFQYEDA---KVNYKNMDKLIKYINERQASGSKYNIFYSTPSCYLNSLHQ- 337
            ::|.|..::||:|.||:|.|:   ...|:|..||..|:|.......|..  :.|.|.|..:|.: 
 Frog   414 KLYRTKVLLVPLGDDFRYTDSLEWDQQYENYQKLFSYMNSHPELHVKAQ--FGTISDYFKALRKA 476

  Fly   338 ------SLESWPNKTQDFFPYAHEKNSFWTGFFTSRPTQKRFERDGNHMLQVAK----------- 385
                  :.:|:|..:.|||.||...:.:|:|:|||||..||.||.....|:.|:           
 Frog   477 GNVDDPNSQSFPVLSGDFFTYADRDDHYWSGYFTSRPFYKRLERVMESHLRAAEILYSFALVQMN 541

  Fly   386 QLSVLANLTSEEHKIDLDYLRQVMGVMQHHDAITGTEKQAVSDDYDRMMYEAIVGASNNARDALR 450
            :...|.:..|.||...|...|:.:|:.|||||||||.|..|..||...::.:::.......||..
 Frog   542 KFDKLQSFPSVEHYKLLTEARRNLGLFQHHDAITGTAKDWVVVDYGTRLFHSLMNLKRVIIDAAH 606

  Fly   451 LLTNMPYGEFESCLRLNISECAFTKD----GADNV-------------LVTLYNPLAHSSTQYVR 498
            :|..    :.:.....|.|...|:.|    ..|::             .:|:|||........|.
 Frog   607 VLVL----KDKDTYAYNPSSPFFSMDDVQPSQDSLPQKTVIKITEIPRYLTVYNPTEQERYSVVS 667

  Fly   499 IPVKEENYQVTDEKGRTVPSEVVPVPWQVLALEYRSNDT-----QHELVFKATVNK--VSSYSIK 556
            :.|.....:|....|:.:.:::..| |        :.|:     .:::.|.|.:..  ::.|.:.
 Frog   668 VYVSSSKVKVISASGKALKAQISAV-W--------NGDSAPLQDMYQVSFLAYLPALGLAVYKLV 723

  Fly   557 KVESSEV-----------KHSSIKKINPREDNN----------SETVVENSVVKLVMDNHTGRLK 600
            :.|:||.           ||   |.||  .|.|          .:..:||:.:||...: :|.|:
 Frog   724 EAENSESIKADYTIFVQGKH---KNIN--SDGNFRIKEVNIVVGDVTIENTYLKLWFSS-SGLLE 782

  Fly   601 SVEM--NGVSEKIVQNFGVY----KSHTSCAYTFRQDGDIELFENDFE--FTVYEGSLVKEV--- 654
            .::.  :|.:..:..:|..|    ....|.||.|..||:.:.:.|...  ..|..||:..||   
 Frog   783 KIQSKEDGKTHGVKVDFIWYGTTNNRDKSGAYLFLPDGEAKPYINADPPVVRVTHGSIFSEVVVF 847

  Fly   655 HQHVNDWISQVIRIY-----EGVSRVELEWMVGPIPIDDKLGSEFVTNFKSEISSNGVFYTDSNG 714
            .:|    ::..:|:|     ||.|    ..:...:.|..:...|.|....|:|:|...||||.||
 Frog   848 FKH----LTHTVRLYNVHGLEGQS----PEITNVVDIRGEFNREIVMRITSDINSKHRFYTDLNG 904

  Fly   715 RELMKRVKDKREDFVSDLSRQPVSGNFYPVTSRIALQDDTKRLVLLNDRSQGGASLEDGALEMLI 779
            .::..|         ..||:.|:..|.||:||...:|||..||.|.:.:|.|.||.:.|.||:.:
 Frog   905 YQIQPR---------RTLSKLPIQANVYPMTSMAYIQDDASRLTLHSAQSLGVASSKSGQLEVFL 960

  Fly   780 HRRHLFNDGGGVGEALNETQYGKGLIARGKLYLILDSATDGDTVTERKTEKELFLP-----FWKF 839
            .||.:.:|..|:|:.:.:.:....|..     |:|:.....|   |::.||.:..|     ....
 Frog   961 DRRLMQDDNRGLGQGVQDNKITSNLFR-----LLLEKRFGKD---EKEDEKPVSYPSILSHITSM 1017

  Fly   840 F----------SKTGGVEITPSKSLPDFNDLPQSVHLLTLEFF--------SEQEILIRFEHFLD 886
            |          :...|..:..:..||..:.:|..||||.|...        |::..||......|
 Frog  1018 FLNHPVIPMAATSDSGSSVLLNAFLPLTSSMPCDVHLLNLRTIQAKVGPIPSDEAALILHRKGFD 1082

  Fly   887 KSEGRVISFNIRDIFDSLGGLAIRETTLDGNMPLSDMKRFKFHAQESGTK-----PSSVEYSTAQ 946
                  ..|:.:|:     ||..  :|..|.:.:        |...:|..     |||:   |..
 Frog  1083 ------CKFSNKDL-----GLLC--STTQGKVSV--------HRLFNGFNIESLIPSSL---TLM 1123

  Fly   947 HKPLEAVKSDEASLFAVTLYPMQIRTFIIK 976
            |.     .|:..:...:.:..|.|:||.||
 Frog  1124 HS-----SSNSKNTTEIRISTMDIKTFRIK 1148

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 90/297 (30%)
Alpha-mann_mid 359..434 CDD:214875 33/86 (38%)
Glyco_hydro_38C 483..973 CDD:285047 129/562 (23%)
man2a1NP_001163963.1 PLN02701 130..1150 CDD:178304 276/1071 (26%)
CE4_SF 167..509 CDD:301698 105/357 (29%)
Alpha-mann_mid 504..590 CDD:214875 33/86 (38%)
Glyco_hydro_38C 755..1145 CDD:285047 105/445 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.