DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIV and man2b2

Sequence 1:NP_609251.2 Gene:LManIV FlyBaseID:FBgn0032067 Length:978 Species:Drosophila melanogaster
Sequence 2:XP_001337519.3 Gene:man2b2 ZFINID:ZDB-GENE-140106-166 Length:1006 Species:Danio rerio

Alignment Length:1093 Identity:276/1094 (25%)
Similarity:478/1094 (44%) Gaps:227/1094 (21%)


  Fly    13 LLVLFAKQSEAVCGYESCPETKANMVNIHLVPHSHNDVGWLKTVDQSYYGYKNKIHHAGVQYILD 77
            ||::...:::|           |..:...::||||.||||:.||.:|.:.|.:.::        .
Zfish     9 LLLMTVSENDA-----------AEKIQAFVIPHSHMDVGWVYTVQESMHAYASNVY--------S 54

  Fly    78 SVVSQLLQDPKRRFIQVETAFFAKWW-NVQSESMKKVVTKLVNEGRFEFTGGAWSMNDEANVNYQ 141
            :||.:|.:...|:||.||..||..|| ||.|:..||.|.:|:.|||.||..|...|:|||..:..
Zfish    55 TVVEELTRVKNRKFIAVEQEFFRLWWTNVASDWHKKQVRQLLLEGRLEFIIGGQVMHDEAVTDVD 119

  Fly   142 GVIDQFTVGLKFLNETFGSCGRPRVGWQIDTFGHSREQAAIFAHMGYDGQFFSRMDHNDKDTRMN 206
            ..|.|.|.|..||.||||.  |||..|.:|.||.|.....:||..|:|....||:|::.||....
Zfish   120 DAILQLTEGHGFLYETFGV--RPRFAWHVDPFGASATTPVLFALAGFDAHLISRIDYDLKDDMQK 182

  Fly   207 DLTMEMIWDASESM-SGVSLFSGMLYNF---------YSDTPGFCFD-ILCTDQPIIDGDSEENN 260
            :..::.:|..|.:: ....:|:..:..|         :|:..||.:: :.....|..||.....:
Zfish   183 NKKLQFVWRGSPTLKEKQEIFTHTMDQFSYCTPSYIPFSNRSGFYWNGVALFPDPPKDGKYPNMS 247

  Fly   261 VKQRVDDFISYAKNV-------SEVYITNHIMVPMGGDFQYEDAKVNYKNMDKLIKYINERQASG 318
            :....:....||:.:       ::.:.::|::.|.|.|.|:.:|.|.:.|||.|:.|||   ...
Zfish   248 LPVTKETVELYAQTMVDNIRLRAQWFRSSHVLWPWGCDKQFYNASVQFSNMDVLMNYIN---THS 309

  Fly   319 SKYNIF--YSTPSCYLNSLHQSLESWPNK-TQDFFPYAHEKNSFWTGFFTSRPTQKRFERDGNHM 380
            .:|.:.  |:|...|..:|||:..||..: .|||.||:.|....||||:.||...|...|..:.:
Zfish   310 DQYGVTVQYATLKDYFQTLHQTNLSWDVRGNQDFLPYSTEPFQAWTGFYGSRNVLKGVARRASSL 374

  Fly   381 LQVAKQLSVLANLTSEEHKIDLDY-------LRQVMGVMQHHDAITGTEKQAVSDDYDRMMYEAI 438
            |..::.|....:::..:..:..::       ||..:..:||||.|||||...|:|.|...:.:.:
Zfish   375 LYASESLFTRYHISYPDGPVQREWALSKLKALRWAVSEVQHHDGITGTESPKVADMYMEHLLQGM 439

  Fly   439 VGA--------------SNNARDALRLLTNMPYGEFESCLRLNISECAFTKDGADNV---LVTLY 486
            :||              ||:..|.::   |.|               ...:..::||   .:.:|
Zfish   440 MGAEELLAAIFLLPQTLSNDIYDQIK---NTP---------------TTARTDSENVPEQHIFVY 486

  Fly   487 NPLAHSSTQYVRIPVKEENYQVTDEKGRTVPSEVVPVPWQVLALEYRSNDTQHELVFKATVN--K 549
            ||||.:.:.||.:.|:.....|.|:.|:.||:::.|      ::|   :.|.::|.|...:.  :
Zfish   487 NPLAWNISTYVNVSVQYAMAVVLDDDGKAVPAQIQP------SME---SSTVYDLFFVVELGGLQ 542

  Fly   550 VSSYSIKKVES-----------SEVKHSSIKKINPRE---DNNSETVVENSVVKLVMDNHTGRLK 600
            ...|:::..:|           ...|.....|.|.|:   .......|.|...||:.|..|..|.
Zfish   543 YRKYTVQFPQSPCDTGSACGATHVAKVVKFNKTNVRQWKKTGRKLLPVLNECYKLMFDQETNLLH 607

  Fly   601 SV--EMNGVSEKIVQNFGVYKSH-------TSCAYTFRQDGDIELFENDFEFTVYEGSLVKEVHQ 656
            |:  ....:..::.|:|..||::       .|..|.|..:|............:..|.::.|:.|
Zfish   608 SITDRSKKIRVRVQQDFWEYKANGDVQSGPISDNYIFTANGSAVPAYKSVVMEIVPGKVISEIRQ 672

  Fly   657 H-------VNDWISQVIRIYEGVS------RVELEWMVGPIPIDDKLGSEFVTNFKSEISSNGVF 708
            :       .|...|.|.|:..|..      |:|..:.|||:.::    .|.|...::.:.:|...
Zfish   673 YFYREEEDANHTYSVVTRVPVGFKGRLSCFRLEQSYKVGPLEVN----RETVFRTRTSLQNNRTL 733

  Fly   709 YTDSNGRELMKRVKDKREDFVSDLSRQPVSGNFYPVTSRIALQDDTKRLVLLNDRSQGGASLEDG 773
            :||:||.::|||.       ....:...|:.|:||:.....::|::.|:|.|::|:.|.|||..|
Zfish   734 FTDNNGYQMMKRT-------YKGYANNTVARNYYPMVRVAYMEDESSRVVFLSERAHGVASLSQG 791

  Fly   774 ALEMLIHRRHLFND---GGGVGEALNETQYGKGLIARGKLYLILDSATDGDTVTERK-------- 827
            .||:::||| |:|:   ..|....||::.     :.|..|:::|.|.....::.:::        
Zfish   792 QLEVMLHRR-LWNNQEWNQGYNLTLNDSS-----VVRPVLWMMLGSPDSLSSIYQQEAVELQHRP 850

  Fly   828 ------------TEKELFLPFWKFFSKTGGVEITPSKSLPDFNDLPQSVHLLTLEF----FSEQ- 875
                        .::|.|          .|..:.|..       |||::|:.:|..    :|.: 
Zfish   851 VVMAIDQPQKLLNQRETF----------SGPSVHPVV-------LPQNLHMQSLSIPGWNYSPEH 898

  Fly   876 -------------EILIRFEHFLDKSEGRVIS----FNIRDIFDSLGGLA-IRETTLDGNMPLSD 922
                         .||:|..|..::.|..|:|    .|::::...:|.:: ::|.:|.|...:||
Zfish   899 SSGGDEKSEVNFDRILLRITHLYEEGESPVLSQPTTINLKEVMQGIGKVSKVQECSLTGTWNISD 963

  Fly   923 MKRFKFHAQESGTKPSSVEYSTAQHKPLEAVKSDEASLFAVTLYPMQIRTFII 975
            ::|:.:...|:..|.....:|        .|..|    |.||:.|.:||||.|
Zfish   964 LQRWNWKTDETMQKTDKSGFS--------GVTQD----FNVTISPKEIRTFFI 1004

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIVNP_609251.2 GH38N_AMII_LAM_like 39..312 CDD:212121 93/292 (32%)
Alpha-mann_mid 359..434 CDD:214875 24/82 (29%)
Glyco_hydro_38C 483..973 CDD:285047 128/574 (22%)
man2b2XP_001337519.3 PLN02701 20..1002 CDD:178304 271/1068 (25%)
GH38-57_N_LamB_YdjC_SF 23..348 CDD:330225 108/338 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D201312at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11607
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.