DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIII and AT5G66150

Sequence 1:NP_001285762.1 Gene:LManIII FlyBaseID:FBgn0032066 Length:1003 Species:Drosophila melanogaster
Sequence 2:NP_201416.1 Gene:AT5G66150 AraportID:AT5G66150 Length:1047 Species:Arabidopsis thaliana

Alignment Length:1086 Identity:352/1087 (32%)
Similarity:544/1087 (50%) Gaps:142/1087 (13%)


  Fly     1 MSSVK-NLAILLALFASYIVQSEA----VCYESCPETKSNMINIHLVPHSHDDLGWLKTVDQYYY 60
            ||.:| :|.:::.|....:|:|..    |.|.:..:.....:|:|||||||||:||||||||||.
plant     6 MSLLKGSLCVIVFLLLLSLVESVKGGGYVKYGTEAKVVPGKLNVHLVPHSHDDVGWLKTVDQYYV 70

  Fly    61 GNKHNIQHAGVQYIFDTVVAELSKDSRRRFIQVETGFFAKWWEDQSETKKKLVKTLVNEGRLEFT 125
            |:.:.||:|.|:.:.|:||..|.:|..|:|:..|..||.:|||:||..:::.|:.||..|:|||.
plant    71 GSNNRIQNACVRNVLDSVVDSLLRDPNRKFVFAEMAFFTRWWEEQSPERQEQVRRLVKSGQLEFV 135

  Fly   126 GGAWSMNDEAAVNYQSVIDQFAVGLKFLNDNFGVCGRPRVGWQIDAFGHSREQASMF-AQMAFDG 189
            .|.|:|||||..:|..:|||...|.:|:...|..  .||..||||.||||..||.:. |::..|.
plant   136 NGGWAMNDEATCHYIDMIDQTTKGHRFIKQQFNT--TPRAAWQIDPFGHSSVQAYLLGAELGLDS 198

  Fly   190 QFFARMDQNDKNKRVDNLGLEMVWDASETLE-EMDFFTGMLYNHYSAPPGFCFDSL-----CQDD 248
            ..|||:|..|:.||.....||::|..|:||: ....||.:.:.||..|.||.::..     .||:
plant   199 VHFARIDYQDREKRKAEKSLEVIWRGSKTLDSSSQIFTNIFFVHYGPPTGFHYEVTDDYVPLQDN 263

  Fly   249 PIIDGKSYDNNVKSRVDDFLNYASNLAGYYRSNHIMVPMGDDFQYENAYMNYKNMDKLIKYVNER 313
            |..||    .|:|..|:||:|.:...|...|.||:|..|||||||:.|...::.||:||.|||: 
plant   264 PRFDG----YNIKEAVNDFVNASLVYANVSRGNHVMWTMGDDFQYQFAESWFRQMDRLIHYVNK- 323

  Fly   314 QASGSKYNIFYSTAGCYLNSLHKSLQSFPNKTQDFLPHSHEAKSFWTGFFTSRPTQKRFERDGNH 378
               ..:.|..|||...|:::.:.:..::|.||.||.|::..|.::|||:|||||..||:.|..:.
plant   324 ---DGRVNALYSTPSLYVDAKNVANVTWPLKTHDFFPYADRAYAYWTGYFTSRPALKRYVRALSG 385

  Fly   379 ILQVAKQLSVLADLSGEEQHKDLDY-LRQIMAVMQHHDAITGTEKQEVSNDYDRLLYDAILGGAN 442
            ....|:||..|.   |:.......| |...:.:.|||||:|||.||.|:|||.:.|   .||.:.
plant   386 YYMAARQLEFLV---GKNSGGPNTYSLGDALGIAQHHDAVTGTAKQHVTNDYMKRL---ALGASE 444

  Fly   443 ---TARDALRVLTNQ-PNGE--------FQSCLKLNISECAFTKE---NADDFMVTLYNPLAHTS 492
               ....||..|.|: |.|.        .|.|..:|||.|..|:|   .....::..||.|....
plant   445 AEAVVNSALACLMNKAPKGGCTKPAIAFSQQCSLMNISYCPSTEETLPGQKSLILVAYNSLGWNR 509

  Fly   493 TQYVRVPVKEDSYQVTDEKGGLVASELVPVPWEVLSLEFRNNDT------------QHELVFKAS 545
            |:.:|:||.:....|.|..|..:.::.:|:  :.::...|:..|            ::.|||||.
plant   510 TEIIRIPVNDAGLSVEDSSGNTLDAQYIPM--DNVTSNLRSFYTKAYLGISSLQRPKYWLVFKAK 572

  Fly   546 VNKIA--TYFIKKIDKTTEVDITVNTQTEQSVNEEESNVKVPKRFKKVHSLKTDLETLDDQETIV 608
            |..:.  |:||.|            ...:.|.|.:.|:|.              |..:::...|.
plant   573 VPPLGWNTFFISK------------ASAQGSNNHKHSSVM--------------LSPMNNTTEIG 611

  Fly   609 QNSLIKLVIDNNTGRLKTV--EMNGVSEDIDQTFGMYKT----AR----SCHYIFRQDADLE--- 660
            ..:| |:|..:::|||:.:  ...|....:||.:..|.:    |:    |..||||.:..|.   
plant   612 PGNL-KMVFSSDSGRLERMYNSRTGADIKVDQNYFWYASNVGDAKDPQVSGAYIFRPNGSLAYPV 675

  Fly   661 ------LVEDAF--------DFTVYDGESVKEVHQHVNEWISQVIRIYEGVNRVEFEWLVGPVPI 711
                  .|..||        ...:..|..:.||||..:.|::||:|:|:.....|||:.:||:.:
plant   676 SSSKICTVTSAFIGNGNVQSKLQIVRGPLIDEVHQQFSPWVAQVVRLYKEKEHAEFEFTIGPISV 740

  Fly   712 DDE--LGKEIVTIFKSGISSGGVFYTDSNGREMMRREKDKREDFSPDLSEQPVSGNYYPVTSRMA 774
            ...  .||||:|...:.:::...||||||||:.::|.:|.|.|:..:::| |::|||||:...|.
plant   741 GKGHLTGKEIITRMVTDMTTAKEFYTDSNGRDFLKRVRDNRTDWHLEVNE-PIAGNYYPLNLGMY 804

  Fly   775 LQDSSKRMVLLNDRSQGGASLEDGRLEMMLHRRHIFADGSGAAEAINE----QQFGKGLIARGKL 835
            ::|....:.:|.||:.||||::||.:|:|||||....|..|..|::.|    .....||..||..
plant   805 IKDEKAELSVLVDRATGGASIKDGEIELMLHRRTSMDDSRGVEESLVETVCVNDTCAGLTIRGNY 869

  Fly   836 FLYLNAIEDGATASERVAEKEIHLPFWKFFSKSNNIQSDVTKTLSDF-----NDLPQSVHLLTLE 895
            ::.:|.:.:|. ...|...:||:.|....|:..|..:...:.|:..:     ..|||::.|:|||
plant   870 YVSINKVGEGG-RWRRETGQEIYSPLLMAFAHENKEKWKASNTVKGYAMDHLYTLPQNIALITLE 933

  Fly   896 PYSKDEILLRLENFLDQTE----GNVVSFSIRQIFDDLGGLEIRETTLDGNLPLSDMK-RLKFHH 955
            ......:||||.:..:..|    ..:....::::|......|:.|.:|..|.....|| ::|:..
plant   934 ELDLGNVLLRLAHLYEAGEDSDYSKIAKVELKKLFSGKMIKEVTEMSLSANQEKVKMKEKMKWKV 998

  Fly   956 DGSGPSHSVPEYFTSLHKPLAADKTQDASEFSVTLKPMQIRTFIIK 1001
            :|.....|         .||..... |.|...|.|.||:||||:::
plant   999 EGEAEQPS---------SPLRGGPV-DKSTLVVELGPMEIRTFVVQ 1034

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIIINP_001285762.1 GH38N_AMII_LAM_like 37..311 CDD:212121 125/281 (44%)
Alpha-mann_mid 358..433 CDD:286360 32/76 (42%)
Glyco_hydro_38C 603..998 CDD:285047 127/438 (29%)
AT5G66150NP_201416.1 GH38N_AMII_LAM_like 47..323 CDD:212121 126/282 (45%)
Alpha-mann_mid 365..438 CDD:214875 32/76 (42%)
Glyco_hydro_38C 498..1031 CDD:285047 155/574 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 649 1.000 Inparanoid score I165
OMA 1 1.010
OrthoDB 1 1.010 D201312at2759
OrthoInspector 1 1.000 T32165
orthoMCL 1 0.900 OOG5_129192
Panther 1 1.100 O PTHR11607
Phylome 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.