DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIII and man2b1

Sequence 1:NP_001285762.1 Gene:LManIII FlyBaseID:FBgn0032066 Length:1003 Species:Drosophila melanogaster
Sequence 2:XP_005169420.1 Gene:man2b1 ZFINID:ZDB-GENE-050327-52 Length:984 Species:Danio rerio

Alignment Length:1063 Identity:429/1064 (40%)
Similarity:590/1064 (55%) Gaps:164/1064 (15%)


  Fly    10 LLALFASYIVQS-----EAVC-YESCPETKSNMINIHLVPHSHDDLGWLKTVDQYYYGNKHNIQH 68
            ||.||...:|.|     .::| |:|||.||.:|:|:|||||:|||:|||||||||:||:::||||
Zfish    11 LLLLFCFSLVFSLPTGRNSICGYKSCPATKPSMLNVHLVPHTHDDVGWLKTVDQYFYGDRNNIQH 75

  Fly    69 AGVQYIFDTVVAELSKDSRRRFIQVETGFFAKWWEDQSETKKKLVKTLVNEGRLEFTGGAWSMND 133
            ||||||.|:|:.:|.||..||||.|||.||.:||..|::..:::|..|||||||||..|.|.|:|
Zfish    76 AGVQYILDSVIDQLQKDPARRFIYVETAFFYRWWRQQNQNTRRIVTQLVNEGRLEFINGGWCMSD 140

  Fly   134 EAAVNYQSVIDQFAVGLKFLNDNFGVCGRPRVGWQIDAFGHSREQASMFAQMAFDGQFFARMDQN 198
            ||..:|.:||||..:||:||||.||.||||||.|.||.|||:||.||:||||.:||.||.|:|..
Zfish   141 EATTHYSAVIDQMTLGLRFLNDTFGECGRPRVAWHIDPFGHAREHASIFAQMGYDGFFFGRLDYQ 205

  Fly   199 DKNKRVDNLGLEMVWDASETLEE--MDFFTGMLYNHYSAPPGFCFDSLCQDDPIIDGKSY-DNNV 260
            ||::|:....:||:|.|||:|..  .|.|||:|.|.|:.|.|||:|..|.|.||.|.... |.||
Zfish   206 DKDRRMKTKEMEMLWRASESLTPPIADLFTGVLPNGYNPPEGFCWDQSCDDAPIRDDPDLEDYNV 270

  Fly   261 KSRVDDFLNYASNLAGYYRSNHIMVPMGDDFQYENAYMNYKNMDKLIKYVNERQASGSKYNIFYS 325
            ...|..|||.:...|.||::|||::.||.|||||||.:.||||||||||||..||.|||.|:.||
Zfish   271 DEIVQKFLNASHKQADYYKTNHIIMTMGSDFQYENANLWYKNMDKLIKYVNALQAKGSKLNVLYS 335

  Fly   326 TAGCYLNSLHKSLQSFPNKTQDFLPHSHEAKSFWTGFFTSRPTQKRFERDGNHILQVAKQLSVL- 389
            |..|||..|:.:..::|.||.||.|::.:|..||||:|||||..|.:||..|..||...||.|| 
Zfish   336 TPSCYLQELNLANFTWPMKTDDFFPYADDAHDFWTGYFTSRPALKLYERLSNSRLQTCNQLEVLG 400

  Fly   390 --ADLSGEEQHKDLDYLRQIMAVMQHHDAITGTEKQEVSNDYDRLLYD-------------AILG 439
              ...||.....|.|.:|:.|.|.|||||::|||||.|:|||.|.|..             |:|.
Zfish   401 GPTSTSGPFGEGDSDTMRRAMGVAQHHDAVSGTEKQHVANDYARRLATGWAHCEVLVSNSLAVLS 465

  Fly   440 GANTARDALRVLTNQPNGEFQSCLKLNISECAFTKENADDFMVTLYNPLAHTSTQYVRVPVKEDS 504
            |:    :|.||.          |..||||.|..| |::..|.:.:||||..|....||:||....
Zfish   466 GS----EAPRVF----------CENLNISVCPLT-ESSHKFSMNVYNPLGRTVRWPVRLPVNGSV 515

  Fly   505 YQVTDEKGGLVASELVPVPWEVLSLEFRNNDTQHELVFKASVNKI--ATYFIKKIDKTTEVDITV 567
            |.|||..|..|.||::|:......:.......:.||||:.....:  :||.|..:.....|..:.
Zfish   516 YNVTDANGKAVDSEVIPLSKSRKEVRQNRGFAKSELVFQVEAPPLGYSTYIISMVQDQPPVSRSK 580

  Fly   568 NTQTEQSVNEEESNVKVPKRFKKVHSLKTDLETLDDQETIVQNSLIKLVIDNNTGRLKTVEMNGV 632
            |.              ||                    :.:||..:|:..|:.||.|.::.....
Zfish   581 NA--------------VP--------------------SSIQNKFLKVTFDSTTGLLSSLTNLET 611

  Fly   633 SEDI--DQTFGMYKTA----RSCH-----YIFR----------QDADLELVEDAFDFTVYDGESV 676
            .:.|  .|.|..|..:    :..|     ||||          :.|:::.|      ::|:  ||
Zfish   612 QQTIRLTQNFFWYNASAGNNKESHQPSGAYIFRPNSSDPFIISKTAEIQAV------SLYN--SV 668

  Fly   677 KEVHQHVNEWISQVIRIYEGVNRVEFEWLVGPVPIDDELGKEIVTIFKSGISSGGVFYTDSNGRE 741
            :||.|..:.|:|||:|:||....:|.||.|||||::|.||||::|...:.|.|.|.|||||||||
Zfish   669 QEVTQRFSPWVSQVVRLYEDRRELELEWTVGPVPVEDGLGKEVITRLDTDIQSSGYFYTDSNGRE 733

  Fly   742 MMRREKDKREDFSPDLSE-QPVSGNYYPVTSRMALQDSSKRMVLLNDRSQGGASLEDGRLEMMLH 805
            ::.|.||.|..:  ||.: :|::|||||:.||..::|..:::.::.|||||.:|:.:|.||:|||
Zfish   734 VLERRKDYRPTW--DLKQTEPIAGNYYPINSRAYIKDDKRQLTVVTDRSQGASSIYNGSLEIMLH 796

  Fly   806 RRHIFADGSGAAEAINEQ-QFGKGLIARGKLFLYLNAIEDGATASERVAEKEIHLPFWKFFSKSN 869
            ||.::.|..|..|.::|. :|..||:|||:|.|.|:..|         |..::|.|.        
Zfish   797 RRLLYDDFRGVGEPLSEPGEFAHGLVARGRLLLTLSPPE---------AAADLHRPL-------- 844

  Fly   870 NIQSDVTKTLSDFND-----------------LPQSVHLLTLEPYSKDEILLRLENFL----DQT 913
             .||.|.:.|..|.|                 ||.:|||||:..:.:|.:|:|||:..    .:|
Zfish   845 -AQSMVLQPLLSFQDGAPSPGTKLEFSGLQAALPPAVHLLTVSQWDQDSVLVRLEHQYQAKESKT 908

  Fly   914 EGNVVSFSIRQIFDDLGGLEIRETTLDGNLPLSDMKRLKFHHDGSGPSHSVPEYFTSLHKPLAAD 978
            ....|:.:::::|..|..|...|.:|..|....||.||.::.:                |.....
Zfish   909 HSQPVTVNLQKLFSTLQVLGASEMSLGANQWKEDMIRLHWNTE----------------KDALPP 957

  Fly   979 KTQDASEFSVTLKPMQIRTFIIK 1001
            ..:|.|.:.||||||:||||:::
Zfish   958 TARDPSSWEVTLKPMEIRTFLLR 980

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIIINP_001285762.1 GH38N_AMII_LAM_like 37..311 CDD:212121 162/277 (58%)
Alpha-mann_mid 358..433 CDD:286360 41/78 (53%)
Glyco_hydro_38C 603..998 CDD:285047 145/439 (33%)
man2b1XP_005169420.1 PLN02701 44..982 CDD:178304 415/1031 (40%)
GH38N_AMII_LAM_like 44..322 CDD:212121 163/278 (59%)
Alpha-mann_mid 368..446 CDD:214875 41/78 (53%)
Glyco_hydro_38C 558..977 CDD:285047 152/497 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64829511
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D201312at2759
OrthoFinder 1 1.000 FOG0001898
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_129192
Panther 1 1.100 O PTHR11607
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.