DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIII and man2a2

Sequence 1:NP_001285762.1 Gene:LManIII FlyBaseID:FBgn0032066 Length:1003 Species:Drosophila melanogaster
Sequence 2:NP_001006777.1 Gene:man2a2 XenbaseID:XB-GENE-981388 Length:909 Species:Xenopus tropicalis

Alignment Length:804 Identity:221/805 (27%)
Similarity:356/805 (44%) Gaps:154/805 (19%)


  Fly    31 ETKSNMINIHLVPHSHDDLGWLKTVDQYYYGNKHNIQHAGVQYIFDTVVAELSKDSRRRFIQVET 95
            |..:..:.:.:|||||:|.||:||.|:|||..        .|:|.:.:|.:|.:|.||:||..|.
 Frog   160 EWDNEPLQVFVVPHSHNDPGWIKTFDKYYYDQ--------TQHILNNMVVKLHEDPRRKFIWSEI 216

  Fly    96 GFFAKWWEDQSETKKKLVKTLVNEGRLEFTGGAWSMNDEAAVNYQSVIDQFAVGLKFLNDNFGVC 160
            .||:|||::.:..|:..|:.||..|:||.|.|.|.|.|||..:|.::|||...|.::|..|..  
 Frog   217 SFFSKWWDNINSQKRAAVRRLVASGQLEMTTGGWVMPDEANTHYFAMIDQMIEGHQWLKKNLD-- 279

  Fly   161 GRPRVGWQIDAFGHSREQASMFAQMAFDGQFFARMDQNDKNKRVDNLGLEMVW------DASETL 219
            ..||.||.:|.||||.....:..:.........|:..:.|........||.:|      |:|   
 Frog   280 ATPRSGWAVDPFGHSSTMPYILRRSNLTSMLIQRVHYSIKKHFAATQSLEFMWRQTWDPDSS--- 341

  Fly   220 EEMDFFTGML-YNHYSAP------PGFCFDSLCQDD-------------PIIDGKSYDNNVKSRV 264
              .|.|..|: :..|..|      |..|    ||.|             .:......|:||..|.
 Frog   342 --TDIFCHMMPFYSYDVPHTCGPDPKIC----CQFDFRRLPGGRINCPWKVPPRAITDSNVAERA 400

  Fly   265 DDFLNYASNLAGYYRSNHIMVPMGDDFQYEN------AYMNYKNMDKLIKYVNER-----QASGS 318
            :..|:.....:..|||..::||:||||:|:.      .::||:   ||..|:|..     ||.  
 Frog   401 NILLDQYKKKSKLYRSKVVLVPLGDDFRYDKIQEWDAQFLNYQ---KLFDYMNSHPELHVQAQ-- 460

  Fly   319 KYNIFYSTAGCYLNSLHKSL--------QSFPNKTQDFLPHSHEAKSFWTGFFTSRPTQKRFERD 375
                 :.|...|.::|:|.:        ..||..:.||..::.....:|||::||||..|..:|.
 Frog   461 -----FGTLSDYFDALYKRMGVVPGIKPPDFPVVSGDFFSYADREDHYWTGYYTSRPFYKSMDRV 520

  Fly   376 GNHILQVAKQLSVL----ADLSGEEQHKDL-DY-----LRQIMAVMQHHDAITGTEKQEVSNDYD 430
            ....|:.|:.|..|    |..:|.|....| ||     .|:.:.:.|||||||||.|:.|..||.
 Frog   521 LESHLRGAEILYSLAINHARKAGTESKYPLSDYALLTDARRNLGLFQHHDAITGTAKEAVVIDYG 585

  Fly   431 -RLLYDAILGGANTARDALR-----VLTNQPNGEFQSCLK-LNISECAFTKEN----------AD 478
             |||:..:    |..|..:.     |:.::....:...:. .:..|...|:|:          |.
 Frog   586 VRLLHSLM----NLKRIIINAAHYLVVADKEKYHYDHSVPFFSTDESRLTQESLPEKTVIKLTAS 646

  Fly   479 DFMVTLYNPLAHTSTQYVRVPVKEDSYQVTDEKGGLVASELVPVPWEVLSLEFRNNDTQHELVFK 543
            ...|.::||:.......|.:.|...:.:|..|.|..||::|.|| |:  |:...|.|. :::.|.
 Frog   647 PRYVVVFNPVEQNRLCVVSLLVNTYNVRVLTEDGQPVAAQLSPV-WQ--SVTDMNPDV-YQVSFT 707

  Fly   544 ASVNKIATYFIKKIDKTTEVDITVNTQTEQSVNEEESNVKVPKRFKKVHSLKTDL-------ETL 601
            |.:..:.....       ::..:::|.|..     :|||:|....:::...|.|:       .:.
 Frog   708 ARLPSLGLSIF-------QLHASIDTHTTL-----KSNVRVHLHGRELSIKKQDVFPVKVAESST 760

  Fly   602 DDQETIVQNSLIKLVIDNNTGRLKTVEMNGVSED--IDQTFGMYKTA----RSCHYIFRQDADLE 660
            ||..  ::|..:::.....||.||:::..|..::  |:..|.:|.|.    :|..|:|..|.:.:
 Frog   761 DDFH--IENQYMQVWFSGTTGLLKSIKRAGEEQEQKINMQFLIYGTRTSKDKSGAYLFLPDGEAK 823

  Fly   661 --LVEDAFDFTVYDGESVKEV---HQHVNEWISQVIRIY-----EGVNRVEFEWLVGPVPIDDEL 715
              ..:|.....|.:|....||   :|||    .||:|:|     ||:: ::...|   :.|.|.:
 Frog   824 PYTPKDPPVVKVTEGPFYSEVTCQYQHV----QQVMRLYNLPGTEGLS-LDISSL---IDIRDHV 880

  Fly   716 GKEIVTIFKSGISSGGVFYTDSNG 739
            .|||.....:.|.|..:|:||.||
 Frog   881 NKEIAMRLSTDIQSEDIFFTDLNG 904

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIIINP_001285762.1 GH38N_AMII_LAM_like 37..311 CDD:212121 96/306 (31%)
Alpha-mann_mid 358..433 CDD:286360 35/86 (41%)
Glyco_hydro_38C 603..998 CDD:285047 42/154 (27%)
man2a2NP_001006777.1 PLN02701 128..>906 CDD:178304 221/805 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1959
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.