DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIII and alpha-Man-IIb

Sequence 1:NP_001285762.1 Gene:LManIII FlyBaseID:FBgn0032066 Length:1003 Species:Drosophila melanogaster
Sequence 2:NP_001262614.1 Gene:alpha-Man-IIb FlyBaseID:FBgn0026616 Length:1249 Species:Drosophila melanogaster

Alignment Length:1159 Identity:279/1160 (24%)
Similarity:461/1160 (40%) Gaps:282/1160 (24%)


  Fly    37 INIHLVPHSHDDLGWLKTVDQYYYGNKHNIQHAGVQYIFDTVVAELSKDSRRRFIQVETGFFAKW 101
            :.|.:|||||:|.|||||...|:..:.        :.|.:.:|.::.:.:...||..|..|...|
  Fly   168 LKIIVVPHSHNDPGWLKTFTNYFQSDS--------RQILNLLVTKMQEYTDMTFIWSEISFLQLW 224

  Fly   102 WEDQSETKKKLVKTLVNEGRLEFTGGAWSMNDEAAVNYQSVIDQFAVGLKFLNDNFGVCGRPRVG 166
            |:....||::.:|.|::.||:|.|.|.|.|.|||.|:...::||...|.::|.:|..|  .|:||
  Fly   225 WDQAHPTKQRALKRLIDAGRIEITTGGWVMTDEANVHIYPMLDQLIEGHQWLKNNLNV--TPKVG 287

  Fly   167 WQIDAFGHSREQASMFAQMAFDG-----------QFFARMDQNDKNKRVDNLGLEMVWDAS-ETL 219
            |.||.|||......:.:...|:|           |:|||....|           .:|... .:.
  Fly   288 WSIDPFGHGSTVPYLLSGANFEGTIIQRIHYAWKQWFARQQSGD-----------FIWKPYWRSR 341

  Fly   220 EEMDFFTGMLYNH------YSAPPGFC----FDSLCQDDPIIDGK--SY--------DNNVKSRV 264
            ::.|...|.|..|      ||. .|.|    |..|..|...|.|:  .|        |:|::|:.
  Fly   342 KDKDSEAGSLLTHNMPFDIYSI-KGSCGPHPFICLNFDFRKIPGEYTEYSVKAQFITDDNLESKA 405

  Fly   265 DDFLNYASNLAGYYRSNHIMVPMGDDFQY------ENAYMNYKNMDKLIKYVNERQASGSKYN-- 321
            ...|...:..|..:..|..::|:||||:|      :..|.|||   |||.::   .|:...||  
  Fly   406 QLLLEQYARTASLFPHNVALIPVGDDFRYNKDREVDQQYQNYK---KLIDHI---MANRRLYNAD 464

  Fly   322 IFYSTAGCYLNSLHKSLQ----SFPNKTQDFLPHS---HEAK-SFWTGFFTSRPTQKRFERDGNH 378
            |.:.|...|..::.:.::    .||....||..:|   .|.: ::|:|:||:||..|....:..|
  Fly   465 IRFGTPSDYFEAIKERMKDHTPGFPTFKGDFFVYSDIFSEGRPAYWSGYFTTRPFYKLLSSELEH 529

  Fly   379 ILQVAKQLSVLADLSG------------EEQHKDLDYLRQIMAVMQHHDAITGTEKQEVSNDYDR 431
            .|:.|:.:..||..:.            |:.::.:...|:.:.:.|||||||||.|..|..||..
  Fly   530 QLRSAEIVFTLAYNTARQAKRENAIKIYEKNYELIINARRNLGLFQHHDAITGTSKAAVMRDYAM 594

  Fly   432 LLYDAILGGANTARDALRVLTNQPNGEFQSCLKLNISECAFTK---------ENADDFMVT---- 483
            .|:::...........|.:|..:........|........|.|         .|.|:...|    
  Fly   595 RLFESTQNMVKMQESCLELLLQKGQPRHHGFLLSEFERDNFNKLPRKMPIQMANGDESTPTVPAG 659

  Fly   484 -----------------LYNPLAHTSTQYVRVPVKEDSYQVTDEKG-GLVASELVPVPWEVLSL- 529
                             |||.||....:.|.:.|:..:.::.::|| .|...::.|| |.:... 
  Fly   660 EGGAGGSSSSGSVGSFVLYNSLAQKRLEVVTLRVQHPNVKIVNDKGVELNHIQINPV-WNITDTY 723

  Fly   530 -------------EFRNNDTQHELVFKASVN--KIATYFIKKIDKTTEVDITVNTQT---EQSVN 576
                         ..|.:..|.|::|.|.:.  .::||.: ::|   ||:...|..|   :....
  Fly   724 EQGLGTSVSGTVGRIRTSTRQFEVMFVAELEPLSLSTYRV-QVD---EVNFKRNIATIYCDDCTE 784

  Fly   577 EEESNVKVPKRFKKVHSLKTDLETLDDQETIVQNSLIKLVIDNNTGRLKTVEMNGVSEDI----- 636
            .:.::|..|:..:...:...:.......:..::|..::|:.|..:|.|||:......:::     
  Fly   785 SQPASVSPPEEIESSPTSVFEARGKPAGDIQLENPHMRLLFDEKSGFLKTITRKNQKKELLKPLQ 849

  Fly   637 -DQTFGMYKTAR--SCHYIFRQD-----ADLELVEDAFDFTVY--DGESVKEVHQHVNEWISQVI 691
             :..|..|::|:  |..|:|:.|     |:.|::|...|..:.  .|....:|......:::..:
  Fly   850 CNIKFAAYRSAQFHSGAYLFKTDPEQSEAEKEVLEGYTDMRIIITSGPIASDVTVIYGPFLAHTV 914

  Fly   692 RIYEG----------VNRVEFEWLVGPVPIDDELGKEIVTIFKSGISSGG--------------- 731
            ||:..          .|.::||    |.|.:.|  .|:...|.:.|.:..               
  Fly   915 RIFNTRTHLDAAIYVENDIDFE----PPPKNRE--TELFMRFVTNIDNIAQAPMQRDPLKEPVDA 973

  Fly   732 -------VFYTDSNGREMMRREKDKREDFSPDLSEQPVSGNYYPVTSRMALQDSSKRMVLLNDRS 789
                   |||:|.||.:...|.|      .|.:.   :.|||:|:||...:|||..|:.||...:
  Fly   974 ATMPELPVFYSDQNGFQYHERIK------VPAIG---IEGNYFPITSGAFIQDSRLRLTLLTTHA 1029

  Fly   790 QGGASLEDGRLEMMLHRRHIFADGSGAAEAINEQQFGKGLIARGKLFLYLNAIEDGATASERVAE 854
            ||.||.|.|:||:||.||.::.|..|..|.:.:.:     :.|.|.:|.:..:..|...::.   
  Fly  1030 QGAASYEPGQLEVMLDRRTLYDDYRGMGEGVVDSR-----LTRHKFWLLVEDLPGGQHVTQP--- 1086

  Fly   855 KEIHLPFWKFFSK------------------SNNIQSDVTKTLSDF------NDLPQSVHLLTLE 895
                 |.:|..|:                  ||..|.::...|...      ..||..|||.||.
  Fly  1087 -----PSYKVLSQQAQQLANALRYPPNLYFVSNLEQPELAAALLPLVRLLPKGPLPCDVHLTTLR 1146

  Fly   896 PYSKDEILLRLENFLDQTEGNVVSFSIRQIFD---DLGGLEIRETTLDGNLPLS-------DMKR 950
            ..|..|:.|       ....:.:....||.||   ..|    ||.:::...|||       .:.|
  Fly  1147 TLSDPELQL-------FPSASALLVLHRQGFDCSVSAG----RELSMEAICPLSSKGLGNVQLGR 1200

  Fly   951 LKFHH------DGSGPSHSVPEYFTSLHKPLAADKTQDASEFSVTLKPMQIRTF 998
            |..|.      .|:....|...|..   :.||          .::|:||::|||
  Fly  1201 LSLHTIEATSLTGTEQKSSRESYHI---RSLA----------EISLEPMELRTF 1241

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIIINP_001285762.1 GH38N_AMII_LAM_like 37..311 CDD:212121 92/312 (29%)
Alpha-mann_mid 358..433 CDD:286360 27/87 (31%)
Glyco_hydro_38C 603..998 CDD:285047 111/482 (23%)
alpha-Man-IIbNP_001262614.1 PLN02701 148..1246 CDD:178304 279/1160 (24%)
GH38N_AMII_GMII_SfManIII_like 167..514 CDD:212120 106/374 (28%)
Alpha-mann_mid 508..596 CDD:286360 27/88 (31%)
Glyco_hydro_38C 813..1241 CDD:285047 111/480 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64897650
eggNOG 1 0.900 E1_KOG1959
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001898
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11607
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.