DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIII and Man2b1

Sequence 1:NP_001285762.1 Gene:LManIII FlyBaseID:FBgn0032066 Length:1003 Species:Drosophila melanogaster
Sequence 2:XP_017456800.1 Gene:Man2b1 RGDID:3039 Length:1046 Species:Rattus norvegicus

Alignment Length:1016 Identity:393/1017 (39%)
Similarity:562/1017 (55%) Gaps:113/1017 (11%)


  Fly     1 MSSVK-NLAILLALFASYIV----QSEAVCYESCPETKSNMINIHLVPHSHDDLGWLKTVDQYYY 60
            |||.. .|.:|...|..:::    .::|..|::||.||..|:|:||:||:|||:|||||||||||
  Rat    22 MSSCNLGLPVLSISFLIWLLLAAPGAQAAGYKTCPTTKPGMLNVHLLPHTHDDVGWLKTVDQYYY 86

  Fly    61 G-NKH----------NIQHAGVQYIFDTVVAELSKDSRRRFIQVETGFFAKWWEDQSETKKKLVK 114
            | :.|          ::|||.||||.|:|:..|..|..||||.||..||::||:.|:...:..|:
  Rat    87 GMDPHLLTFMPIVMSDVQHASVQYILDSVIYSLLNDPTRRFIYVEMAFFSRWWKQQTNVTQDAVR 151

  Fly   115 TLVNEGRLEFTGGAWSMNDEAAVNYQSVIDQFAVGLKFLNDNFGVCGRPRVGWQIDAFGHSREQA 179
            .||.:|||||..|.|.||||||.:|.:::||..:||:||.|.||..|.|||.|.||.||||||||
  Rat   152 NLVRQGRLEFVNGGWVMNDEAATHYGAIVDQMTLGLRFLQDTFGSDGLPRVAWHIDPFGHSREQA 216

  Fly   180 SMFAQMAFDGQFFARMDQNDKNKRVDNLGLEMVWDASETLE--EMDFFTGMLYNHYSAPPGFCFD 242
            |:||||.|||.|..|:|..||..|...|.:|.:|.||.:|:  ..|.|||:|.|:|:.|...|:|
  Rat   217 SLFAQMGFDGFFLGRIDYQDKFNRKRKLKMEELWRASASLKPPAADLFTGVLPNNYNPPKDLCWD 281

  Fly   243 SLCQDDPIIDG-KSYDNNVKSRVDDFLNYASNLAGYYRSNHIMVPMGDDFQYENAYMNYKNMDKL 306
            .||.|.|::|. .|.:.|....||.|||.||:...|||:||.::.||.|||||||.|.:||||||
  Rat   282 VLCTDPPVVDDPTSPEFNANKLVDYFLNLASSQKKYYRTNHTVMTMGSDFQYENANMWFKNMDKL 346

  Fly   307 IKYVNE-RQASGSKYNIFYSTAGCYLNSLHKSLQSFPNKTQDFLPHSHEAKSFWTGFFTSRPTQK 370
            |:.||| :||:|||.::.|||..|||..|:|:..::..|..||.|::.....||||:|:|||..|
  Rat   347 IRLVNEQQQANGSKVHVLYSTPSCYLWELNKANLTWTVKEDDFFPYADGPHMFWTGYFSSRPALK 411

  Fly   371 RFERDGNHILQVAKQLSVLADLS---GEEQHKDLDYLRQIMAVMQHHDAITGTEKQEVSNDYDRL 432
            |:||...:.|||..||..|....   |.....|...|.:.|||:|||||:|||.:|.|.|||.:.
  Rat   412 RYERLSYNFLQVCNQLEALVGPEAKVGPYGSGDSAPLNEAMAVLQHHDAVTGTARQNVVNDYAKQ 476

  Fly   433 L------YDAILGGANTARDALRVLTNQPNGEFQSCLKLNISECAFTKENADDFMVTLYNPLAHT 491
            |      .:.::..| .||.:|.      ...|..|.::|||.|. ..:.::.|.|.:|||:...
  Rat   477 LAAGWGPCEVLVSNA-LARLSLY------KQNFSFCREINISICP-ASQTSEHFRVIIYNPVGRK 533

  Fly   492 STQYVRVPVKEDSYQVTDEKGGLVASELVPVPWEVLSLEFRNNDTQHELVFKASVNKI--ATYFI 554
            ....||:||.|..:.|.|.....::|.:|.||      ...:...|.||:|.|||..:  :.|.:
  Rat   534 VDLMVRLPVSEGIFLVKDPNDRRISSNVVMVP------SAYSKTYQWELLFPASVPALGFSIYSV 592

  Fly   555 KKIDKTTEVDITVNTQTEQSVNEEESNVKV-PKRFKKVHSLKTDLETLDDQETIVQNSLIKLVID 618
            .|:               ...|.:..|:.. ||:.|             .:..:::|..|:...|
  Rat   593 NKM---------------SGHNHQAHNLTARPKKSK-------------SRVLVIENKYIRATFD 629

  Fly   619 NNTGRLKTVE--MNGVSEDIDQTFGMYKTA--------RSCHYIFRQDADLEL-VEDAFDFTVYD 672
            ::||.|:.:|  ...:|..:.|.|..|..:        .|..||||......| |......|:..
  Rat   630 SDTGLLRKIENLEQNISLPVRQGFFWYNASAGDEESPQASGAYIFRPSHRKPLPVSHWAQVTLVK 694

  Fly   673 GESVKEVHQHVNEWISQVIRIYEGVNRVEFEWLVGPVPIDDELGKEIVTIFKSGISSGGVFYTDS 737
            ...|:||||:.:.|.|||||:|||...:|.||.|||:|:.|:.|||:::.|.:.:.:.|.|:|||
  Rat   695 TNLVQEVHQNFSAWCSQVIRLYEGQRHLELEWTVGPIPVKDDWGKEVISRFNTPMRTRGQFFTDS 759

  Fly   738 NGREMMRREKDKREDFSPDLS---EQPVSGNYYPVTSRMALQDSSKRMVLLNDRSQGGASLEDGR 799
            ||||:::|    |:||.|..:   .:||:||||||.:|:.:.|...::.:|.||||||:||.||.
  Rat   760 NGREILKR----RDDFRPTWTLNQTEPVAGNYYPVNTRIYITDGHMQLTVLTDRSQGGSSLLDGS 820

  Fly   800 LEMMLHRRHIFADGSGAAEAINEQQFGKGLIARGKLFLYLNAIEDGATASERVAEKEIHLP---- 860
            ||:|:|||.:..|..|.||.:.|...|..:  ||:..:.|:::.|.|.....:||:|:..|    
  Rat   821 LELMVHRRLLVDDERGVAEPLLETDTGDKV--RGRHLVILSSVSDAAARHRLLAEQEVLAPQVVL 883

  Fly   861 ----FWKFFSKSNNIQSDVTKTLSDFNDLPQSVHLLTLEPYSKDEILLRLEN-FLDQTEGN---- 916
                ...:.|::..:|....:     .:||..||||||..:....:|||||: |..:.:.|    
  Rat   884 AHGGSSPYHSQAPKMQFSALR-----RELPPQVHLLTLARWGPKMLLLRLEHQFAVKEDSNRNLS 943

  Fly   917 -VVSFSIRQIFDDLGGLEIRETTLDGNLPLSDMKRLKFHHD 956
             .|:.:::.:|.......::||||..|.|||.:.|||:..|
  Rat   944 SPVTLNLQNLFKTFTINYLQETTLAANQPLSRVSRLKWMTD 984

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIIINP_001285762.1 GH38N_AMII_LAM_like 37..311 CDD:212121 151/288 (52%)
Alpha-mann_mid 358..433 CDD:286360 37/78 (47%)
Glyco_hydro_38C 603..998 CDD:285047 132/383 (34%)
Man2b1XP_017456800.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64849751
eggNOG 1 0.900 E1_KOG1959
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D201312at2759
OrthoFinder 1 1.000 FOG0001898
OrthoInspector 1 1.000 T618275
orthoMCL 1 0.900 OOG5_129192
Panther 1 1.100 O PTHR11607
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
98.800

Return to query results.
Submit another query.