DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LManIII and LManI

Sequence 1:NP_001285762.1 Gene:LManIII FlyBaseID:FBgn0032066 Length:1003 Species:Drosophila melanogaster
Sequence 2:NP_001260350.1 Gene:LManI FlyBaseID:FBgn0032253 Length:950 Species:Drosophila melanogaster

Alignment Length:978 Identity:596/979 (61%)
Similarity:747/979 (76%) Gaps:42/979 (4%)


  Fly    36 MINIHLVPHSHDDLGWLKTVDQYYYGNKHNIQHAGVQYIFDTVVAELSKDSRRRFIQVETGFFAK 100
            |||:|||||||||:||||||||||||:::.|||||||||.||||.||.|||.||||||||.||||
  Fly     1 MINVHLVPHSHDDVGWLKTVDQYYYGSQNKIQHAGVQYILDTVVEELLKDSSRRFIQVETFFFAK 65

  Fly   101 WWEDQSETKKKLVKTLVNEGRLEFTGGAWSMNDEAAVNYQSVIDQFAVGLKFLNDNFGVCGRPRV 165
            |:.:|:||.::.||.||.:|||||.||||||||||.|:||||:|||.:||::|.|.||.||||.|
  Fly    66 WYSEQTETVQRAVKKLVAQGRLEFAGGAWSMNDEATVHYQSVVDQFNLGLRYLKDTFGDCGRPTV 130

  Fly   166 GWQIDAFGHSREQASMFAQMAFDGQFFARMDQNDKNKRVDNLGLEMVWDASETLEEMDFFTGMLY 230
            |||||.||||||.||:||||||:|:||||||..||.:|:.:|.:||:|.:||:|:..:.||||||
  Fly   131 GWQIDPFGHSREMASIFAQMAFNGEFFARMDYVDKKQRMLDLEMEMIWQSSESLKNSNIFTGMLY 195

  Fly   231 NHYSAPPGFCFDSLCQDDPIIDGKSYDNNVKSRVDDFLNYASNLAGYYRSNHIMVPMGDDFQYEN 295
            ||||||||||||..|:|.|||||:||||||.:||.:|::|..|::..|||.|||||||||||||:
  Fly   196 NHYSAPPGFCFDINCEDAPIIDGESYDNNVDARVSEFIDYVKNMSKSYRSTHIMVPMGDDFQYED 260

  Fly   296 AYMNYKNMDKLIKYVNERQASGSKYNIFYSTAGCYLNSLHKSLQSFPNKTQDFLPHSHEAKSFWT 360
            |.:|:|||||||||||:||::||:.|:||||..|||..||:..|::||||:||.|:|.::.|:||
  Fly   261 AAVNFKNMDKLIKYVNDRQSTGSQVNVFYSTPSCYLYELHQLKQTWPNKTEDFFPYSSDSHSYWT 325

  Fly   361 GFFTSRPTQKRFERDGNHILQVAKQLSVLADLSGEEQHKDLDYLRQIMAVMQHHDAITGTEKQEV 425
            |:||||||||||.|||||..|..|||||||:|||.:..:|||.|.|.|.:||||||:||||||.|
  Fly   326 GYFTSRPTQKRFHRDGNHFFQTVKQLSVLANLSGTQYSEDLDNLSQAMGIMQHHDAVTGTEKQAV 390

  Fly   426 SNDYDRLLYDAILGGANTARDALRVLTNQPNGEFQSCLKLNISECAFTKENADDFMVTLYNPLAH 490
            ::||||||:.||:|..|:||||||.|||..:|||:|||:||||.||||::.|::.:|||.|||||
  Fly   391 ASDYDRLLFKAIVGAENSARDALRSLTNLTSGEFESCLELNISVCAFTQDTANNVIVTLVNPLAH 455

  Fly   491 TSTQYVRVPVKEDSYQVTDEKGGLVASELVPVPWEVLSLEFRNNDTQHELVFKASVNKIATYFIK 555
            :||||||||.|.::|.||||||..|.||:|||||:||:||.|.|||||||||:|||:|||.:.|:
  Fly   456 SSTQYVRVPAKNENYIVTDEKGREVFSEVVPVPWQVLALEHRPNDTQHELVFEASVDKIANFLIR 520

  Fly   556 KIDKTTEVDITVNTQTEQSVNEEESNVKVPKRFKKVHSLKTDLETLDDQETIVQNSLIKLVIDNN 620
            .:....              |..|..|:.|            :|...|:.| |:.||:||..|..
  Fly   521 VLPSPK--------------NIAEDQVQFP------------VERSQDELT-VETSLVKLTFDTT 558

  Fly   621 TGRLKTVEMNGVSEDIDQTFGMYKTAR----------SCHYIFRQDADLELVEDAFDFTVYDGES 675
            ||.||||:|||.:|:|.||||:||..|          |..|:||...|:|:|.:..:.:.|:|..
  Fly   559 TGGLKTVKMNGFTENIQQTFGIYKGYRGNNGESKNRSSGAYVFRPYGDIEIVNNKVELSFYNGTK 623

  Fly   676 VKEVHQHVNEWISQVIRIYEGVNRVEFEWLVGPVPIDDELGKEIVTIFKSGISSGGVFYTDSNGR 740
            ||||||||||||||||||||.||||||||||||:|.||::||||:|.|.|.|||.|.||||||||
  Fly   624 VKEVHQHVNEWISQVIRIYEDVNRVEFEWLVGPIPTDDDVGKEIITRFSSNISSKGKFYTDSNGR 688

  Fly   741 EMMRREKDKREDFSPDLSEQPVSGNYYPVTSRMALQDSSKRMVLLNDRSQGGASLEDGRLEMMLH 805
            |::.||:::||.|:||:|| .:||||||||.:::|||..||:.|||||:|||.||:||.||:|||
  Fly   689 EILERERNQREHFTPDMSE-AISGNYYPVTGQISLQDDEKRITLLNDRAQGGTSLKDGELELMLH 752

  Fly   806 RRHIFADGSGAAEAINEQQFGKGLIARGKLFLYLNAIEDGATASERVAEKEIHLPFWKFFSKSNN 870
            ||.:..|..|..||:||.|:|.|||||||::|.|:|: || ..::|:.:.::...|||||||||.
  Fly   753 RRLLNDDAFGVGEALNETQYGTGLIARGKIYLILDAV-DG-KPNQRLLQHQLDQHFWKFFSKSNG 815

  Fly   871 IQSDVTKTLSDFNDLPQSVHLLTLEPYSKDEILLRLENFLDQTEGNVVSFSIRQIFDDLGGLEIR 935
            :.|.....:.||..:|:||.||:|||||||:||:|||||  .||||||||:|..:|:.|.|.:|.
  Fly   816 VASVNRNMIPDFFGIPESVELLSLEPYSKDQILIRLENF--NTEGNVVSFNIYPLFESLDGYQIW 878

  Fly   936 ETTLDGNLPLSDMKRLKFHHDGSGPSHSVPEYFTSLHKPLAADKTQDASEFSVTLKPMQIRTFII 1000
            |||||||:.|.|:||.||..||:|...|..||:.:.|.||.|:.|.:||.|.|||.|||||||||
  Fly   879 ETTLDGNMLLEDVKRFKFAQDGTGSIPSSVEYYHAPHNPLTANSTMNASGFVVTLVPMQIRTFII 943

  Fly  1001 KKE 1003
            :::
  Fly   944 QQK 946

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LManIIINP_001285762.1 GH38N_AMII_LAM_like 37..311 CDD:212121 195/274 (71%)
Alpha-mann_mid 358..433 CDD:286360 53/75 (71%)
Glyco_hydro_38C 603..998 CDD:285047 232/405 (57%)
LManINP_001260350.1 GH38N_AMII_LAM_like 2..276 CDD:212121 195/274 (71%)
Alpha-mann_mid 323..398 CDD:286360 53/75 (71%)
Glyco_hydro_38C 536..941 CDD:285047 234/423 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64053648
eggNOG 1 0.900 E1_KOG1959
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 649 1.000 Inparanoid score I165
Isobase 1 0.950 0 Normalized mean entropy S4230
OrthoDB 1 1.010 D201312at2759
OrthoFinder 1 1.000 FOG0001898
orthoMCL 1 0.900 OOG5_129192
Panther 1 1.100 P PTHR11607
RoundUp 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.