DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IDH3B and CG7755

Sequence 1:NP_001317692.1 Gene:IDH3B HGNCID:5385 Length:387 Species:Homo sapiens
Sequence 2:NP_611110.2 Gene:CG7755 FlyBaseID:FBgn0034105 Length:378 Species:Drosophila melanogaster

Alignment Length:364 Identity:85/365 (23%)
Similarity:166/365 (45%) Gaps:30/365 (8%)


Human    31 AAHAASRSQAEDVRV------EGSFPVTMLPGDG-VGPELMHAVKEVFKAAAVPVEFQEHHLSEV 88
            ||:|...::|:.|.|      .|...|:::.|.. :|.:....|..:..::.||||.|     .:
  Fly    30 AAYAKGDARADPVNVLPKSKYGGINTVSLVTGTTIIGQQGAQFVSSLLSSSRVPVEVQ-----VI 89

Human    89 QNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMT 153
            :....:|....||    .|:.|    :|...:...|.....:::...|||:......:|.||:..
  Fly    90 EAGQDDEYFHSVL----RNRTA----VHVDNQADAEAKQKALKICNDLDLYVFKTRTRSFPGFKC 146

Human   154 RHNNLDLVIIREQTEGEYSSLEHESARGVIECLKIVTRAKSQRIAKFAFDYATKKGRGKVTAVHK 218
            |...:|:.:|.:...|.::.||:....||:|.|.:|::..:.:..::||..|.|.||.:||.::|
  Fly   147 RFPGVDIQLIGQNNMGIFNELEYSPVEGVVEALSVVSQKGNDKYLRYAFKAAAKAGRKRVTLINK 211

Human   219 ANIMKLGDGLFLQCCEEVAELYPK-IKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAA 282
            |....:.||..::..:.:...|.. ::.|.|.::....:|:..|..||.|.....|...:..:.:
  Fly   212 AKEWPISDGSLVEAAQRLHCHYKDCLELELMEVEEAISRLMTEPTYFDCLFASERYATFLSAICS 276

Human   283 GLVGGAGVVPGESYSAEYAVFETGARHPFAQAVG-RNIANPTA--MLLSASNMLRHLNLEYHSSM 344
            |:.|||.:.........:|||:     |....:. .|.||.:|  ::.:..::.:||..:..:..
  Fly   277 GVCGGANLFSAVEIGDHHAVFK-----PLQTKLSLTNYANLSAYGIVSTIVDLFQHLGHDKCADA 336

Human   345 IADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTK 383
            :...:|:.:..| :||::.||..|....|.::|..|:.:
  Fly   337 LWCELKRTMDEG-IRTKEFGGQDTGEYVICNIINQLRCR 374

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IDH3BNP_001317692.1 None
CG7755NP_611110.2 Iso_dh 51..371 CDD:294303 78/339 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.