DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PIG-U and GAB1

Sequence 1:NP_609238.1 Gene:PIG-U FlyBaseID:FBgn0032052 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_013564.1 Gene:GAB1 SGDID:S000004451 Length:394 Species:Saccharomyces cerevisiae

Alignment Length:413 Identity:118/414 (29%)
Similarity:212/414 (51%) Gaps:40/414 (10%)


  Fly     1 MDSKFFKLLLLGGAVRFYFCRTPLAP----MIGNRVEFATPLNSHKRMQEGIFLLQSGIDPYLGD 61
            |||...|:.|  |.:........|.|    .:...|||:||:.|.:.:||||:||::.|..|...
Yeast     1 MDSTALKVAL--GCIAIRLAVNSLFPSLQQQLDQSVEFSTPVTSFRSLQEGIYLLRNNIQVYNHG 63

  Fly    62 LVHESPLILSALSGLFQKYPQFLPIFYIILDICTAALLYAMSLRFVKQKQDQQDKERKEYAKDTE 126
            :||..|:::..|| ||.. .:.:.:.|.::|   ..:.|.::                |..|..:
Yeast    64 VVHHPPILIFFLS-LFNS-DRLISLIYALID---GLIAYQLT----------------EVTKAFK 107

  Fly   127 ELQFGPLDKLDIPELVIVAYLFSPLTVMSCIGMTSTVISNLFLAFFFYC-LVKGMLIPCLLVLAF 190
            .|:.    |:.:|.|:   |..:|||::|||..:|.:.:|..::...|| |.:|.::...::::.
Yeast   108 NLKL----KVWLPGLL---YAVNPLTLLSCISRSSIIFTNFAISSSLYCILAEGNVLLSSVMISI 165

  Fly   191 ETVRSFYPIVLIAPLLLVFSRNSVRRGVAIAALFIVSCLIVAVANYFVL--NSWNFLDGTLGFIF 253
            ....|.|||:|:.|||.:.  .|.|:.:..|.:.|:|.||:.:.:|.:|  .||:||....|.|.
Yeast   166 SGYLSVYPILLLIPLLGML--KSWRQRILSAIVSILSLLILLLFSYSILGSQSWSFLTQVYGSII 228

  Fly   254 YFRDLQPNIGLFWYFFTEMFEHFRTMFLITFQLNATVLYLVPLSIKLRKEPLLLATVLVALMAVF 318
            .|..:.||:||:||||.|||:.|...|...|.:...| ::.|.:::..|:|.....:.:..:.:.
Yeast   229 TFEKVFPNLGLWWYFFIEMFDTFIPFFKAVFNIFIAV-FITPFTLRYHKQPFYAFILCIGWIVLT 292

  Fly   319 RAYPSLGDVGFYLALLPLWKRCWKFMAHGFVVFTFFLVTLSMMGALWHLWIYAGSANANFYFGAT 383
            :.||||||.||:.:.||.:...:.::.:..:....||..:.:....:|||:..||.|:||::..:
Yeast   293 KPYPSLGDAGFFFSFLPFFTPLFGYLRYPIISALLFLHAIVLAPIFYHLWVVLGSGNSNFFYAIS 357

  Fly   384 LAFSTGQIFLITDLLFAHVKREF 406
            |.::.....::.||.:|.::.|:
Yeast   358 LVYALAIASILVDLNWAMLRIEY 380

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PIG-UNP_609238.1 PIG-U 10..386 CDD:284205 110/383 (29%)
GAB1NP_013564.1 PIG-U 10..360 CDD:310970 110/383 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C153092491
eggNOG 1 0.900 E1_KOG2552
Hieranoid 1 1.000
Homologene 1 1.000 H6553
Inparanoid 1 1.050 183 1.000 Inparanoid score I933
Isobase 1 0.950 0 Normalized mean entropy S1982
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004158
OrthoInspector 1 1.000 T1136489
orthoMCL 1 0.900 OOG5_129002
Panther 1 1.100 LDO PTHR13121
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R924
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.