DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PIG-U and AT1G63110

Sequence 1:NP_609238.1 Gene:PIG-U FlyBaseID:FBgn0032052 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_850969.2 Gene:AT1G63110 AraportID:AT1G63110 Length:469 Species:Arabidopsis thaliana

Alignment Length:469 Identity:138/470 (29%)
Similarity:223/470 (47%) Gaps:85/470 (18%)


  Fly     3 SKFFKLLLLGGAVRFYFCRTPLAPMIGNRVEFATPLNSHKRMQEGIFLLQSGIDPYLGDLVHESP 67
            |:|:...|...|.|......|....:.:|.|.:|||.|.:|:.||.:|.|:.:.||.|.:.|.||
plant    11 SRFWIWALSSIAFRLILISFPGNLNLSSRPEVSTPLTSIRRLAEGYWLKQASMSPYAGSMYHGSP 75

  Fly    68 LILSALSGL----FQKYPQFL--PIFYIILDICTAALLYAMSLRFVKQKQDQQDKERKEYAKDTE 126
            |:||.|..|    .:..|..|  .:.::|.||.:|.||.|:.           .|.:..|..:..
plant    76 LLLSVLGPLTVQRIKGQPSHLLCSLVFVIADILSAMLLRAIG-----------QKLQMAYGLNAR 129

  Fly   127 ELQF--GPLDKLDIP--ELVIVAYLFSPLTVMSCIGMTSTVISNL--FLAFFFYCLVKGMLIPCL 185
            .|.|  ...||:.:|  ::..:.||::|.|::||:|::::.|.||  .||.|.....:..|....
plant   130 LLGFLKSSRDKVILPCGDIAALVYLWNPFTIVSCVGLSTSPIENLAVILALFGAVTRRVPLAAFG 194

  Fly   186 LVLAFETVRSFYPIVLIAPLLLVF-----------------------SRNSVRRGVAIAALFIVS 227
            ||:|  |..|.||..|..|::.:.                       |.::|.:...:.....:.
plant   195 LVIA--THLSLYPATLTIPIIFLLGYGLDAPPIKLFLQTRSVENEESSTSTVSKQAKLKQTTHLP 257

  Fly   228 CLIVAVANYFV----------------LNSWNFLD----GTLGFIFYFRDLQPNIGLFWYFFTEM 272
            .|...||::..                ||.:..|:    .|.|||....||.||||:|||||.|:
plant   258 FLWKTVAHFLFWVLLWSLYVLILCALSLNKYGGLEEMFKRTYGFILSIEDLSPNIGVFWYFFAEV 322

  Fly   273 FEHFRTMFLITFQLNATVLY-LVPLSIKLRKEPLLLATVLVALMAVFRAYPSLGDVGFYLALLPL 336
            |:.||..|||...:|  :|: |:||:|:|:..|..||.:.:|:.::.::|||:||...||:|   
plant   323 FDFFRNFFLIVLHVN--ILFMLLPLAIRLKHRPCFLAFIYLAISSILKSYPSVGDSALYLSL--- 382

  Fly   337 WKRCWKFMAHGF--VVFTFFL----VTLSMMGALWH-LWIYAGSANANFYFGATLAFSTGQIFLI 394
                |....:..  :.|:|||    :.:|::..:.| |||:.|:.|||||||..:.::..||..:
plant   383 ----WALFVNELLDMKFSFFLFCGYLGISLLSPVMHNLWIWRGTGNANFYFGNAIGYACFQIVFV 443

  Fly   395 TDLLFAHVKREFCL 408
            .:.:.|.:..:..|
plant   444 VESVSAMLNHDRAL 457

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PIG-UNP_609238.1 PIG-U 10..386 CDD:284205 132/439 (30%)
AT1G63110NP_850969.2 PIG-U 18..435 CDD:284205 132/439 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H6553
Inparanoid 1 1.050 178 1.000 Inparanoid score I1431
OMA 1 1.010
OrthoDB 1 1.010 D1339553at2759
OrthoInspector 1 1.000 T125077
orthoMCL 1 0.900 OOG5_129002
Panther 1 1.100 LDO PTHR13121
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.