DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PIG-U and pigu

Sequence 1:NP_609238.1 Gene:PIG-U FlyBaseID:FBgn0032052 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001016206.1 Gene:pigu XenbaseID:XB-GENE-999831 Length:435 Species:Xenopus tropicalis

Alignment Length:436 Identity:175/437 (40%)
Similarity:255/437 (58%) Gaps:25/437 (6%)


  Fly     8 LLLLGGAVRFYFCRTPLAPMIGNRVEFATPLNSHKRMQEGIFLLQSGIDPYLGDLVHESPLILSA 72
            ::|:...||....|:.||..|..|||..:||||.||:.||:.||..|:.||.|||.||:||||. 
 Frog     8 VVLVAVTVRAILFRSSLAEFISERVEVVSPLNSWKRVVEGMALLDLGVSPYSGDLFHETPLILY- 71

  Fly    73 LSGLFQKYPQFLPIFYIILDICTAALLYAM-----SLRFVKQKQDQQDKERKEYAKDTEELQFGP 132
               ||.....:..|.::|.|..||..||..     .|.|.|||   ...|.|.|:::..:|...|
 Frog    72 ---LFHFLVDYAEIVFMITDALTAITLYLAVKDYNKLMFKKQK---LLLELKRYSQEGHDLLRVP 130

  Fly   133 LDKLDIPELVIVAYLFSPLTVMSCIGMTSTVISNLFLAFFFYCLVKGMLIPCLLVLAFETVRSFY 197
            .:...:|..|.:.||.:|.||:||:..::.||:|..:|.|....|||..:...:.|:..|.:|.|
 Frog   131 TEMYYVPLKVALFYLLNPYTVLSCVAKSTCVINNAVIALFILATVKGSRLLSAVFLSVATYQSLY 195

  Fly   198 PIVLIAP-LLLVFSRNSVRRGVAIAALFIVS---------CLIVAVA-NYFVLNSWNFLDGTLGF 251
            ||.|:.| ||.:..:..:...:...:.::.|         ||.|.|. ::|:||||:|:....||
 Frog   196 PITLLPPALLYLLQKEFIPIKMKSPSFWLFSCQYCSMYLGCLCVLVCHSFFLLNSWDFIPSIYGF 260

  Fly   252 IFYFRDLQPNIGLFWYFFTEMFEHFRTMFLITFQLNATVLYLVPLSIKLRKEPLLLATVLVALMA 316
            |....||.||||||||||.||||||...|:..||:| ...|:|||:|||:..|:.|..:.:|:::
 Frog   261 ILSVPDLTPNIGLFWYFFAEMFEHFSLFFVCVFQIN-VFFYIVPLTIKLKDHPMFLMFMQLAVIS 324

  Fly   317 VFRAYPSLGDVGFYLALLPLWKRCWKFMAHGFVVFTFFLVTLSMMGALWHLWIYAGSANANFYFG 381
            :|::||::|||..|:||||:|....:|:.:.|:|....:|...:...||||||||||||:|||:.
 Frog   325 IFKSYPTVGDVALYMALLPMWAHLSRFLRNVFIVSCMLIVCTLLFPVLWHLWIYAGSANSNFYYA 389

  Fly   382 ATLAFSTGQIFLITDLLFAHVKREFCLFNGQKIL-IDGEEARIVLK 426
            .||:|:.|||.|::|..:|.::||:.|.:|..:. .||.||.:|||
 Frog   390 ITLSFNVGQILLVSDYFYAFLRREYHLHHGLYLTKKDGTEATLVLK 435

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PIG-UNP_609238.1 PIG-U 10..386 CDD:284205 157/392 (40%)
piguNP_001016206.1 PIG-U 19..394 CDD:284205 154/383 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C153084082
eggNOG 1 0.900 E1_KOG2552
Hieranoid 1 1.000
Homologene 1 1.000 H6553
Inparanoid 1 1.050 309 1.000 Inparanoid score I2445
OMA 1 1.010
OrthoDB 1 1.010 D1339553at2759
OrthoFinder 1 1.000 FOG0004158
OrthoInspector 1 1.000 T1060468
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R924
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.