DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PIG-U and SPAC1952.01

Sequence 1:NP_609238.1 Gene:PIG-U FlyBaseID:FBgn0032052 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001342842.1 Gene:SPAC1952.01 PomBaseID:SPAC1952.01 Length:408 Species:Schizosaccharomyces pombe

Alignment Length:421 Identity:126/422 (30%)
Similarity:204/422 (48%) Gaps:66/422 (16%)


  Fly     4 KFFKLLLLGGAVRFYFCRTPLAPMIGNRVEFATPLNSHKRMQEGIFLLQSGIDPYLGDLVHESPL 68
            |...||.:...:::|...|.:|..:..|:|.:||::...|::||::|.::|:|||.|.:.::|||
pombe     8 KLLGLLSISFFLQWYLANTWIAEFLYRRIEVSTPVSGFLRVREGLYLYENGLDPYSGGVFYQSPL 72

  Fly    69 ILSALSGLFQKYPQFLPIFYIILDICTAALLYAMSL-RFVKQKQDQQDKERKEY----------- 121
            :|                   ||:.| ..||..:|: |||             |           
pombe    73 LL-------------------ILNYC-CELLGGISVTRFV-------------YTSISTMGGLFV 104

  Fly   122 ---AKDTEELQFGPLDKLDIPELVIVAYLFSPLTVMSCIGMTSTVISN---LFLAFFFYCLVKGM 180
               ||....|....:.....|..:.|.||.:|||.:..|..::.:|.|   |...:|..|....:
pombe   105 YLIAKQARVLDPNQVLSTCSPLWISVIYLLNPLTFLPGIACSADMILNFTTLMTIYFASCGSYAI 169

  Fly   181 LIPCLLVLAF---ETVRSFYPIVLIAPLLLVFSRNSVR-RGVAIAALFIVSCLIVAVANYFVLNS 241
            ...|:.:..|   ..:..|:|..||    |....:|:: |.:.:..||.::.||  :.:.|.|||
pombe   170 YACCMALTVFINPNALLLFFPSYLI----LRKCNSSIKFRQIFVVFLFYLAGLI--ITSGFFLNS 228

  Fly   242 WNFLDGTLGFIFYF--RDLQPNIGLFWYFFTEMFEHFRTMFLITFQLNATVLYLVPLSIKLRKEP 304
            .:||  .:.|..|.  .||.||:||:||||||||..|||.||..|.: ..:::::|:||:|...|
pombe   229 LSFL--KIPFRVYLDSHDLTPNLGLWWYFFTEMFNEFRTFFLFVFAI-LPLMFVLPVSIRLYYLP 290

  Fly   305 LLLATVLVALMAVFRAYPSLGDVGFYLALLPLWKRCWKFMAHGFVVFTFFLVTLSMMGALWHLWI 369
            |.:...|:.|.::|:||||:.|:..:|:|||::.:....|.:..:.....:..|.:..|.:|.||
pombe   291 LPITIALIGLHSLFKAYPSICDLSIFLSLLPIFNKVQDRMRYSLLTNNAIVFALVLGSAFYHSWI 355

  Fly   370 YAGSANANFYFGATLAFSTGQIFLITDLLFA 400
            ..|..|||||:.:.|..:.|....|.|.|.|
pombe   356 TLGCGNANFYYASNLILALGLSLKIMDFLKA 386

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PIG-UNP_609238.1 PIG-U 10..386 CDD:284205 118/400 (30%)
SPAC1952.01NP_001342842.1 PIG-U 10..371 CDD:310970 120/403 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H6553
Inparanoid 1 1.050 170 1.000 Inparanoid score I1172
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004158
OrthoInspector 1 1.000 T1125428
orthoMCL 1 0.900 OOG5_129002
Panther 1 1.100 LDO PTHR13121
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R924
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.