DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PIG-U and Pigu

Sequence 1:NP_609238.1 Gene:PIG-U FlyBaseID:FBgn0032052 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001004721.1 Gene:Pigu MGIID:3039607 Length:435 Species:Mus musculus

Alignment Length:433 Identity:166/434 (38%)
Similarity:250/434 (58%) Gaps:19/434 (4%)


  Fly     8 LLLLGGAVRFYFCRTPLAPMIGNRVEFATPLNSHKRMQEGIFLLQSGIDPYLGDLVHESPLILSA 72
            :|::...||....|:.||..|..|||..:||:|.||:.||:.||..|:.||.|.:.||:|||:. 
Mouse     8 VLVVAVTVRAALFRSSLAEFISERVEVVSPLSSWKRVVEGLALLDLGVSPYSGAVFHETPLIIY- 71

  Fly    73 LSGLFQKYPQFLPIFYIILDICTAALLYAMSLRFVKQ--KQDQQDKERKEYAKDTEELQFGPLDK 135
               ||.....:..:.::|.|..||..||.....|.|.  |:.:...|..:||.|..||...|::.
Mouse    72 ---LFHFLIDYAELVFMITDALTAIALYFAIQDFNKVVFKKQKLLLELDQYAPDVAELIRTPMEM 133

  Fly   136 LDIPELVIVAYLFSPLTVMSCIGMTSTVISNLFLAFFFYCLVKGMLIPCLLVLAFETVRSFYPIV 200
            ..||..|.:.||.:|.|::||:..::..|:|..:|||....:||.:....:.||..|.:|.||:.
Mouse   134 RYIPLKVALFYLLNPYTILSCVAKSTCAINNTLIAFFILTTIKGSVFLSAVFLALATYQSLYPVT 198

  Fly   201 LIAP-LLLVFSRNSVRRGVAIAALFIV----------SCLIVAVANYFVLNSWNFLDGTLGFIFY 254
            |.|| ||.:..|..:...|...|.:|.          |.:::...::|:|:||:|:....|||..
Mouse   199 LFAPGLLYLLQRQYIPVKVKSKAFWIFSWEYAMMYTGSLVVIVCLSFFLLSSWDFIPAVYGFILS 263

  Fly   255 FRDLQPNIGLFWYFFTEMFEHFRTMFLITFQLNATVLYLVPLSIKLRKEPLLLATVLVALMAVFR 319
            ..||.||||||||||.||||||...|:..||:| ...|.|||:|||::.|:....:.:|::::|:
Mouse   264 VPDLTPNIGLFWYFFAEMFEHFSLFFVCVFQIN-VFFYTVPLAIKLKEHPIFFMFIQIAIISIFK 327

  Fly   320 AYPSLGDVGFYLALLPLWKRCWKFMAHGFVVFTFFLVTLSMMGALWHLWIYAGSANANFYFGATL 384
            :||::|||..|:|..|:|...::|:.:.||:....:|...:...||||||||||||:||::..||
Mouse   328 SYPTVGDVALYMAFFPVWNHLYRFLRNIFVLTCIIIVCSLLFPVLWHLWIYAGSANSNFFYAITL 392

  Fly   385 AFSTGQIFLITDLLFAHVKREFCLFNGQKILI-DGEEARIVLK 426
            .|:.|||.||:|..:|.::||:.|.:|..:.. ||.||.:|||
Mouse   393 TFNVGQILLISDYFYAFLRREYYLTHGLYLTAKDGTEAMLVLK 435

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PIG-UNP_609238.1 PIG-U 10..386 CDD:284205 146/389 (38%)
PiguNP_001004721.1 PIG-U 20..394 CDD:284205 144/379 (38%)
May be involved in recognition of long-chain fatty acids in GPI. {ECO:0000250} 269..289 16/20 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C153088508
eggNOG 1 0.900 E1_KOG2552
Hieranoid 1 1.000
Homologene 1 1.000 H6553
Inparanoid 1 1.050 303 1.000 Inparanoid score I2636
Isobase 1 0.950 0 Normalized mean entropy S1982
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004158
OrthoInspector 1 1.000 T1084488
orthoMCL 1 0.900 OOG5_129002
Panther 1 1.100 LDO PTHR13121
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R924
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.